KEGG   Paraburkholderia xenovorans LB400: Bxe_A1020Help
Entry
Bxe_A1020         CDS       T00340                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00670  One carbon pool by folate
bxe00790  Folate biosynthesis
bxe01100  Metabolic pathways
Module
bxe_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bxe_A1020
   00670 One carbon pool by folate
    Bxe_A1020
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bxe_A1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: ABE31927
JGI: BxeA1020
UniProt: Q13VG2
Position
1:3763477..3763977
Genome map
AA seq 166 aa AA seqDB search
MTTLTLIVARANNGVIGRDNQLPWRLPEDLAFFKRTTMGAPIIMGRKTHESIGRPLPGRR
NIVVTRDATRRFQGCDTAATLQEALKLAAQDQAPEAFLIGGAQLYVEGLRQADKLIITEI
SADFEGDATFPELDETEWEEVAHETHRADAPNDFDYAFVTYKRKGA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctcaccctgatcgtcgctcgcgccaacaacggcgtgatcggccgcgacaac
cagttgccctggcgacttcccgaagacctcgcgttcttcaagcgcaccactatgggcgcg
cccatcatcatgggccgcaaaacgcatgagtcgatcggccggcccttgcctggacgccgc
aacattgtcgtgacgcgcgatgccacacgccgcttccagggttgcgacacggccgcgacg
ctccaggaggcgctcaagctcgccgcgcaggatcaggcgcccgaagcgtttctgatcggc
ggcgcgcagttgtatgtggaaggcttgcggcaagcggacaagctcatcatcaccgaaatt
tccgccgacttcgaaggcgacgccacgttccccgaactcgacgaaaccgagtgggaagaa
gtcgcgcatgaaacgcaccgcgcggacgcgccgaacgatttcgactacgcgttcgtgacg
tacaaacgcaagggtgcctga

DBGET integrated database retrieval system