KEGG   Paraburkholderia xenovorans LB400: Bxe_A1151Help
Entry
Bxe_A1151         CDS       T00340                                 

Gene name
amnH
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00360  Phenylalanine metabolism
bxe00362  Benzoate degradation
bxe00620  Pyruvate metabolism
bxe00621  Dioxin degradation
bxe00622  Xylene degradation
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_A1151 (amnH)
   00650 Butanoate metabolism
    Bxe_A1151 (amnH)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bxe_A1151 (amnH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_A1151 (amnH)
   00622 Xylene degradation
    Bxe_A1151 (amnH)
   00621 Dioxin degradation
    Bxe_A1151 (amnH)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bxe_A1151 (amnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABE31797
JGI: BxeA1151
UniProt: Q13VU2
Position
1:complement(3633829..3634770)
Genome map
AA seq 313 aa AA seqDB search
MTRKFKAAIIGSGNIGTDLMIKIMRHGRHIEVGAMVGIDPASDGLARASRLGVGTTHEGV
EGLTRLPIFEEIDFVFDATSAGAHVHNDALLRKYKPGIRVIDLTPAAIGPYCIPVVNGKQ
NLDALNVNMVTCGGQATVPMVAAVSRVTQVHYGEIVASIASKSAGPGTRANIDEFTETTS
KAIEVVGGASKGKAIIVLNPADPPLIMRDTVYTLSDVADEAAIADSVARMAADVQSYVPG
YRLKQTVQFDRVENLNVPGVGRISGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAGLRTAE
QMAARMTAGTVAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaaaattcaaagccgccatcatcggcagcggaaacatcggcacggacctgatg
atcaagatcatgcgtcacggccgtcacatcgaagtaggggccatggtggggatcgaccct
gcctcggacggtcttgcccgtgcttctcgcctgggcgtaggcaccacacacgaaggtgta
gagggtttgacgcgtctgcccatcttcgaggaaatcgacttcgtgttcgatgctacgagc
gccggggctcacgtccacaacgatgcactgctgcgcaagtacaaacccggtatccgcgtc
attgacctgacgccggccgccatcggtccgtactgcatccccgtagtcaatggcaaacag
aacttggatgcgctgaacgtcaacatggtgacttgcggcggccaggcaactgtccccatg
gtagccgcggtctctcgcgtgacccaggtccactatggcgagatcgtggcttctatcgct
agtaagagtgccgggccagggactcgggccaacatcgacgagttcaccgagacaacctca
aaggccattgaagttgtgggtggcgcatcgaaaggcaaggccatcatcgtgttgaacccc
gccgatccgcccttgatcatgcgcgacaccgtgtacacgctcagcgacgtggctgacgaa
gcagctattgccgattcggttgcccggatggccgccgatgtccagagctacgtgccagga
tatcgattgaagcagaccgtgcagtttgatcgtgtcgagaacctgaacgtgccaggcgtg
ggccgcatctccggcctgaaaaccagcattttcctggaagtcgaaggcgcagcgcactac
ttgccggcttacgcgggaaatctcgacatcatgaccagcgccggccttcgcacagccgaa
caaatggcagcacggatgacggccgggacggtcgccgcctga

DBGET integrated database retrieval system