KEGG   Burkholderia xenovorans: Bxe_A1151Help
Entry
Bxe_A1151         CDS       T00340                                 

Gene name
amnH
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bxe  Burkholderia xenovorans
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bxe_A1151 (amnH)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_A1151 (amnH)
   00650 Butanoate metabolism
    Bxe_A1151 (amnH)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bxe_A1151 (amnH)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_A1151 (amnH)
   00622 Xylene degradation
    Bxe_A1151 (amnH)
   00621 Dioxin degradation
    Bxe_A1151 (amnH)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bxe_A1151 (amnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3633829..3634770)
Genome map
AA seq 313 aa AA seqDB search
MTRKFKAAIIGSGNIGTDLMIKIMRHGRHIEVGAMVGIDPASDGLARASRLGVGTTHEGV
EGLTRLPIFEEIDFVFDATSAGAHVHNDALLRKYKPGIRVIDLTPAAIGPYCIPVVNGKQ
NLDALNVNMVTCGGQATVPMVAAVSRVTQVHYGEIVASIASKSAGPGTRANIDEFTETTS
KAIEVVGGASKGKAIIVLNPADPPLIMRDTVYTLSDVADEAAIADSVARMAADVQSYVPG
YRLKQTVQFDRVENLNVPGVGRISGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAGLRTAE
QMAARMTAGTVAA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaaaattcaaagccgccatcatcggcagcggaaacatcggcacggacctgatg
atcaagatcatgcgtcacggccgtcacatcgaagtaggggccatggtggggatcgaccct
gcctcggacggtcttgcccgtgcttctcgcctgggcgtaggcaccacacacgaaggtgta
gagggtttgacgcgtctgcccatcttcgaggaaatcgacttcgtgttcgatgctacgagc
gccggggctcacgtccacaacgatgcactgctgcgcaagtacaaacccggtatccgcgtc
attgacctgacgccggccgccatcggtccgtactgcatccccgtagtcaatggcaaacag
aacttggatgcgctgaacgtcaacatggtgacttgcggcggccaggcaactgtccccatg
gtagccgcggtctctcgcgtgacccaggtccactatggcgagatcgtggcttctatcgct
agtaagagtgccgggccagggactcgggccaacatcgacgagttcaccgagacaacctca
aaggccattgaagttgtgggtggcgcatcgaaaggcaaggccatcatcgtgttgaacccc
gccgatccgcccttgatcatgcgcgacaccgtgtacacgctcagcgacgtggctgacgaa
gcagctattgccgattcggttgcccggatggccgccgatgtccagagctacgtgccagga
tatcgattgaagcagaccgtgcagtttgatcgtgtcgagaacctgaacgtgccaggcgtg
ggccgcatctccggcctgaaaaccagcattttcctggaagtcgaaggcgcagcgcactac
ttgccggcttacgcgggaaatctcgacatcatgaccagcgccggccttcgcacagccgaa
caaatggcagcacggatgacggccgggacggtcgccgcctga

DBGET integrated database retrieval system