KEGG   Burkholderia xenovorans LB400: Bxe_A1302Help
Entry
Bxe_A1302         CDS       T00340                                 

Definition
di-haem cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bxe  Burkholderia xenovorans LB400
Brite
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bxe_A1302
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3488297..3489682)
Genome map
AA seq 461 aa AA seqDB search
MAGVETPRCARRVRLAAAFALTAMTMSLAACDAGAPGTAAAASEAASAAAGAAHSSAPAA
VTASAAPAAAQAGQTRAQVYESVRQMTALGKQLFFDASLSGSGKLACASCHSPEHAFSPA
NVLSVQLGGSDMHRTGLRAAPTLKYLQSVPAFAEHYHESDDEGDESVDAGPTGGLTWDGR
VDRGADQARIPLLSSFEMGSTPARVAAAVKAAPYADAFRAAFGEHVFDSDDATFKAVLQA
LETFEQTPEIFYPYTSKYDAYLAGNAQLTQAELRGLQLFNDEQKGNCASCHISQRTRDGA
PPQFSDFGLIAIGVPRNRALPVNRDPHFYDLGACGPERTDLKGRAEFCGIFRTPTLRNVA
LKKSFFHNGIYHSLDQVVRFYAERDTNPGKFYPVSKGKVQKFDDLPQKYWANLNTDPPFD
RKPGDKPVFDEAEIKDVVAFLNTLTDGYKAGGGLANVAAAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggctggggtcgagacgccgcgttgtgccaggcgcgtgcgcctcgcggcggcgttcgcg
ctgacggccatgaccatgagcctcgccgcttgcgatgcgggtgcgcccggtacggcggct
gccgcgagtgaagcggcgagcgcggccgccggcgcggcgcattcgtccgcgccggcggcg
gtgacggcttcggcggcgccggccgctgcccaagcgggccagacacgcgcgcaggtctac
gaatccgtgcggcaaatgacagcgctcggcaagcagctgtttttcgatgcgtcgctctcc
ggttcgggcaagctcgcttgtgcgtcgtgccacagtccggagcatgcgttttcgccggcc
aatgtgttatcggttcaactgggcggcagcgatatgcaccgcaccggcctgcgtgccgcg
ccgacgctgaagtatctgcaatcggtgccggcgttcgccgagcactatcacgagtcggat
gacgaaggcgacgaaagcgtggacgcaggaccgaccggcgggctgacatgggacggccgc
gtcgaccgtggtgctgaccaggcgcgcattccgctgctctcgtcgttcgagatgggcagc
acgccggccagggtcgccgcggcggtcaaggccgcgccgtacgccgacgctttccgcgcg
gccttcggcgaacacgttttcgatagcgacgacgccaccttcaaggccgtcctgcaagcg
ctcgaaaccttcgagcagacacccgagatcttctatccgtacaccagcaaatacgacgcg
tatctcgcgggcaacgcgcagttgacgcaagccgagctgcgcggcctgcaactcttcaac
gacgaacagaaaggcaattgcgcgagttgccacatcagccaacgtaccagggacggcgcg
ccgccgcagttcagcgactttggtctgatcgcgatcggcgtgccgcgcaatcgtgcactg
cccgtgaatcgcgatccgcatttctatgacctcggcgcgtgcggcccggagcgcaccgat
ctgaagggacgtgccgagttttgcggcattttccgcacaccgacactacgcaacgtggca
ttgaaaaagagcttctttcacaacggcatctaccattcgctcgatcaggtggtgcgcttc
tatgcggagcgcgacacgaaccccgggaagttctatccggtgtccaaaggcaaggtgcag
aagttcgacgatctgccgcagaagtactgggccaatctgaataccgacccaccgttcgac
cgcaagccgggcgacaagccggtgttcgacgaagccgaaatcaaggacgtggtcgcgttt
ctgaatacgctgacggatggatacaaggcaggtggcggattggcgaatgtagcggccgcg
aaatga

DBGET integrated database retrieval system