KEGG   Burkholderia xenovorans: Bxe_A1334Help
Entry
Bxe_A1334         CDS       T00340                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bxe  Burkholderia xenovorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bxe_A1334
   00052 Galactose metabolism
    Bxe_A1334
   00500 Starch and sucrose metabolism
    Bxe_A1334
   00520 Amino sugar and nucleotide sugar metabolism
    Bxe_A1334
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bxe_A1334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3450581..3451462
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELQARGKDKLLELVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVGDNPFAVILADDLLYGTPPVMAQMIEVFDHYHSSVIGVEEIPAQETKSYGIVDGKEWE
DSIIKMSGIVEKPEPNVAPSNLGVVGRYVLKPRIFEHLRALKPGAGGELQLTDAIQSLLA
DEQVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSPVLEG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagttacaaaggcagtttttccggtagcaggtcttggcacccggttcctccct
gccacgaaggcgagcccgaaagagatgctgccgatcgtcgacaagccgctgatccagtac
gcggtcgaagaggcaatggcggccggcatcaccgaaatgatcttcgtcacgggccgcagc
aagcgcgcgatcgaggaccacttcgacaaatcttacgaaatcgaagccgagttgcaggcg
cgcggcaaggacaagctgctggaactcgtgcgcagcatcaagccgagccatgtggactgt
ttctacgtgcgtcagccggaagcgttgggcctgggccacgcggtgctgtgcgccgaaaag
ctggtgggcgacaacccgtttgccgtgattctcgcggacgacctgctgtacggcacgccg
cctgtcatggcgcagatgatcgaggtgttcgatcactatcacagctcggtgatcggcgtc
gaagagatcccggcgcaggaaaccaagtcgtacggcatcgtcgacggcaaggagtgggaa
gattcgatcatcaagatgtcgggcatcgtcgaaaagccggagccgaacgtggcgccgtcg
aatcttggtgtggtgggccgctatgtgctcaagccgcgcatcttcgaacatctgcgtgcg
ctgaagccgggcgcaggcggtgaattgcagctgacggacgcaattcaatcgctgctcgcc
gacgaacaggtgctggcgtacaagtatcacggcacgcgtttcgactgcggcagcaagctg
ggttatctgaaggcgacggttgaattcgcgctgcgtcacccggaagtggctgcggatttc
gaagaatatctgcgcacgcgttcgccggtactggaaggctga

DBGET integrated database retrieval system