KEGG   Paraburkholderia xenovorans LB400: Bxe_A1395Help
Entry
Bxe_A1395         CDS       T00340                                 

Definition
(GenBank) Putative acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00620  Pyruvate metabolism
bxe00640  Propanoate metabolism
bxe00680  Methane metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A1395
   00620 Pyruvate metabolism
    Bxe_A1395
   00640 Propanoate metabolism
    Bxe_A1395
  Energy metabolism
   00680 Methane metabolism
    Bxe_A1395
Enzymes [BR:bxe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bxe_A1395
Lipid biosynthesis proteins [BR:bxe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bxe_A1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABE31559
JGI: BxeA1395
UniProt: Q13WI0
Position
1:complement(3374952..3376622)
Genome map
AA seq 556 aa AA seqDB search
MNLDGQTYESLTANFAWQIPARYNIGVDVCDKWADGSGRLALIYEDPEGTATRYTFDELK
ALSDRFANALLAAGAQRGDRIGIFLSQSVETAIAHLAAYKAGMVAVPLFALFGVDAIEHR
LGDSGAVALITDHGGVQKVDEIRAALPSLRNVFSVDIDRDNGDPHAPVRSFWHALKSAPA
GFTPVDTGADDPAVIIYTSGTTGKPKGALHGHRVLPGHLPGVEMSQQGFPAHATLIWTPA
DWAWIGGLFDVLLPSWHHGVPVLARRFAKFDGEAAFDLMARHAVSHTFLPPTALKMMRGV
ERPERWSLALRSVASGGESLGEELIGWGRKALGVTINEFYGQTECNVVVSSCAALFEPRF
GAIGRAVPGHHVAIVDMDGNELPPGAIGDIAVAAPDPVMFLGYWGNEAATREKFRGKFLV
TGDLGTCDADGFIRFVGRGDDVITSAGYRIGPASIEDSLLRHPAVSMAVVIGAPDRERTE
IVMAFVVLNPGFAGDAALVREIQQHVKTRLAAHEYPREIRFVDSLPLTATGKVIRKALRE
GLEQDADNPASKPERR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgacggccagacctacgaatcgctgacggcaaacttcgcgtggcagatcccg
gcgcgctacaacatcggcgtggacgtgtgcgataaatgggccgacggttcgggccgtctc
gcgctgatctacgaagatcccgagggcactgcgacccgctatacgttcgacgagttgaaa
gcgctgtccgaccgcttcgccaacgcgctgctcgcagcgggtgcgcaacgcggcgaccgg
atcggcatcttcctgtcgcaatccgtcgaaacggctatcgcgcatctcgccgcctacaag
gccggcatggtggccgtgccgctgttcgcgctgttcggcgtcgatgcgatcgaacatcgg
ctcggcgatagtggcgccgtggcgctgattaccgatcacggcggcgtgcagaaggtcgac
gaaatccgcgcggcgttgccgtcgctgcgcaatgttttcagcgtggatatcgatcgggac
aacggcgatccgcatgcgccggtgcgttcgttctggcacgcgctgaagagcgcgcccgcg
ggtttcacacccgtcgataccggcgcggacgatcccgcggtgatcatctatacgtcgggc
acgaccggcaaaccgaagggcgcgctgcatgggcaccgcgtgttgccaggccacctgccg
ggcgtcgagatgtcgcaacagggctttcccgcgcacgccacgctgatctggacgcccgcc
gactgggcatggatcggcggcctgttcgacgtgctcttgccctcctggcatcacggcgtg
ccggtactcgcgcgccgctttgcgaaattcgacggcgaggccgcgttcgatctgatggcg
cgtcacgcggtctcgcatacgtttctgccgcccaccgcattgaagatgatgcgcggcgtc
gaacgtcccgaacgctggagcctcgcgttgcgttcggtggcgagcggcggtgaatcgctc
ggcgaggaattgatcggctggggccgcaaagcgctgggcgtcacgatcaacgagttctat
gggcagacggagtgcaacgtcgtggtgtcatcgtgcgcggcgctcttcgaaccgcgcttc
ggcgcgattggccgcgcggtgccggggcatcatgtcgcgattgtcgatatggacggcaac
gaattgccgccgggcgcgatcggcgatatcgcggtggccgcgcccgatccggtcatgttt
ctcggctactggggcaacgaggcggcgacgcgcgagaaattccgcggcaagtttctggtg
accggcgacctcggcacatgcgacgcggacggcttcatccgttttgtcggccgtggcgac
gacgtgatcacgagcgccggctaccgcatcgggccggcttcgatcgaagactcgctgctg
cgtcatccggctgtttcgatggcggtcgtgatcggcgcgccggatcgcgagcgcaccgag
atcgtgatggcgttcgtggtgctgaaccccggctttgccggcgacgcggcgctggtgcgc
gagatccagcagcatgtcaaaacgcgtctcgcggcgcacgagtatccgcgcgagattcgc
tttgtcgacagcctgccgttgacggcgaccggcaaggtgatccgcaaagccttgcgcgag
ggactggaacaggacgcggacaatcccgcgtcaaaacccgagcgccgatga

DBGET integrated database retrieval system