KEGG   Paraburkholderia xenovorans LB400: Bxe_A1542Help
Entry
Bxe_A1542         CDS       T00340                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00020  Citrate cycle (TCA cycle)
bxe00620  Pyruvate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A1542
   00020 Citrate cycle (TCA cycle)
    Bxe_A1542
   00620 Pyruvate metabolism
    Bxe_A1542
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bxe_A1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N DEC-1_N HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABE31413
JGI: BxeA1542
UniProt: Q13WX6
Position
1:complement(3207104..3208771)
Genome map
AA seq 555 aa AA seqDB search
MSQAIEVKVPDIGDYKDIPVIEVLVKAGDTVEKEQSLVTLESDKATMDVPSSAAGVVKEV
KVKVGDNVSEGSLIVVLEGAEGGAAAPAPAPAAAPAAAPAPAPAAAPAAAPAPAPAASGG
GLQEVKVPDIGDYKDIPVIEVAVKVGDRVEKEQSLVTLESDKATMDVPSSAAGVVKEVKV
KVGDTVSEGSVIVVVEAEGGAAAPAPAPKQQAVEQPSDAPATPSPAPAAPSALAQAPVIP
AGEGGARHASHASPSVRKFARELGVDVTQVQGTGPKGRITQADVTAFIKGVMTGQRAAPA
GAAAPAAAGGGELNLLPWPKIDFTKFGPVDPKPLSRIKKISGANLHRNWVMIPHVTNNDE
ADITELEALRVQLNKENEKAGVKITMLAFVIKAVVSALKQFPTFNASLDGDNLVFKQYFH
IGFAADTPNGLVVPVIRDADKKGLIDIAREMAELSKAARDGKLKPDQMQGGCFSISSLGG
IGGTNFTPIINAPEVAILGLSRGATKPVWDGKQFVPRLILPLSLSYDHRVIDGAAAARFN
AYLGAILADFRRVIL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggacatcggcgattacaaggacattcctgtg
atcgaggtgctggtgaaggcgggtgacaccgtcgagaaagagcagtcgctcgttacgctg
gagtccgacaaggcgaccatggacgtgccgagctcggccgccggcgtcgtcaaggaagtg
aaggtcaaggtcggcgacaatgtgtcggaaggttcgctgatcgtcgtgctggaaggcgct
gaaggcggcgcggccgcgccggcaccggcgcctgcggccgcaccggcagcggctcctgcg
ccggcaccggctgcggcccccgctgctgcgccggcgcccgcgcccgccgcgagcggcggc
ggtctgcaggaagtcaaggtgccggatatcggcgactacaaagacattcccgtgatcgaa
gtcgcggtgaaggtcggtgatcgtgtcgagaaagagcagtcgctagtgacgctcgaatcc
gacaaggcgaccatggacgtgccgagctcggccgccggcgtcgtcaaggaagtgaaggtc
aaggtcggcgataccgtgtcggaaggctcggtgatcgtcgtggtggaagcggaaggcggc
gcggccgcgccggcaccggcgccgaagcagcaagccgtcgagcagccgtcggatgcgccg
gccacgccgtcgccggctccggcggcgccttcggcgctcgctcaggcgccggtgattccg
gctggcgaaggcggcgcgcgtcacgcgagccatgcgtcgccgtccgtgcgcaagttcgcg
cgcgaactgggcgtcgacgtgacgcaggtgcagggtacgggtccgaagggccgcattacg
caagccgacgtgactgccttcatcaagggcgtcatgaccggtcagcgtgcggcgccggct
ggtgcggccgcaccggctgcggcgggcggcggcgaactgaatctgctgccgtggccgaag
atcgacttcacgaagttcggtccggtcgatccgaagccgctgtcgcgcatcaagaagatt
tcgggcgcgaatctgcatcgcaactgggtcatgattccgcatgtcacgaacaacgacgaa
gcggacatcacggaactcgaagcgctgcgcgtgcaactgaacaaggaaaacgaaaaggcc
ggcgtgaagatcacgatgctggcattcgtgatcaaggcggttgtttcggctttgaagcag
ttcccgacgttcaacgccagcctcgacggcgacaacctggtgttcaagcagtacttccat
atcggctttgcggccgacacgccgaatggtctggtcgttcctgtcattcgcgatgcggac
aagaagggtttgatcgatatcgcgagggaaatggccgagttgtcgaaggctgcgcgcgac
ggcaagctgaagccggatcagatgcaaggcgggtgcttctcgatctcttctttgggtggc
attggcggcacgaacttcacgccgattatcaatgcgcctgaagtcgccattcttggtctg
tcgcgcggtgcgacgaagccggtttgggatggtaagcagttcgtgccgcgtttgatcctg
ccgctttctttgtcgtatgaccatcgggtgatcgatggcgctgcggcggccaggttcaat
gcttatcttggggcgattcttgccgatttccggcgtgtgattctttga

DBGET integrated database retrieval system