KEGG   Burkholderia xenovorans LB400: Bxe_A1647Help
Entry
Bxe_A1647         CDS       T00340                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A1647
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_A1647
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_A1647
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bxe_A1647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3089740..3091350
Genome map
AA seq 536 aa AA seqDB search
MANPQSPHATLQLPQGMEITAEIKPGYDAILTREALELVAALHRTFEPRRQQLLQARAER
TKRLDAGERPDFLAETKSVREGDWKIAPLPQDLQCRRVEITGPVERKMIINALNSGADSY
MTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKSYALNDKVATLIVRPRGWHLDEK
HVKVDGKRVSGSIFDFALFMVHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEA
VGVPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCL
ADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIRNDPAANDKAMAGVRSDKA
RDAGDGYDGGWVAHPGLVAIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLLDFRPETPIT
ENGLRNNINVGIHYLGAWLTGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRK
VTAELVRAMSAQELDKVKQAVGGDTKPYERAAQIFEEMSTSEQFTDFLTLPLYEEI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacccgcagtcaccgcatgcaacgttgcagttgccgcaaggcatggaaatcacg
gctgagatcaagccgggctatgacgcgattctcacgcgcgaagcgctcgaactcgtcgcc
gcgctgcaccgcactttcgaaccgcgccgccagcaattgttgcaggcgcgcgcggaacgc
acgaagcgcctcgacgccggcgagcgtcccgacttcctcgccgaaacgaaaagcgtgcgt
gaaggcgactggaaaatcgcaccgctgccgcaggacttgcagtgccgtcgcgtggaaatc
accggcccggtggagcgcaagatgatcatcaacgcgctgaattcgggcgcggattcatac
atgacggacttcgaagattcgaatgcgccgagctgggataaccagatcaccggccatatc
aatctgaaggacgcggtgcgccgcacgatctcgctggagcagaacggcaagtcgtacgcg
ctgaacgacaaggtcgccacgctgatcgtgcgtccgcgcggctggcatctggatgagaag
cacgtaaaggtggacggcaagcgtgtgtcgggcagcatcttcgacttcgcgctcttcatg
gtgcacaacgcgaaggaactgctcgcgcgcggctcgggcccgtacttctatctgccgaag
atggagagccatctcgaagcgcgcctgtggaacgacatcttcgtggccgcgcaggaagcg
gtcggcgtgccgcgcggcacgattcgcgcgacggtgctgatcgaaacgatcctcgccgcg
ttcgaaatggacgagatcctgtacgagctgcgcgaacacagctcgggcctgaacgccggc
cgctgggactacatcttctcggcgatcaagaaattcaagtccgaccgtgatttctgcctg
gccgaccgctcgcagatcaccatgacctcgccgttcatgcgcgcctatgcgctgctgttg
ctgaagacctgccatcgccgcaatgcgccggcgatcggcggcatgagcgcgctgattccg
atcaggaacgatccggctgcgaacgacaaggcaatggccggcgtacgctcggacaaggcg
cgcgatgccggcgacggctacgacggcggctgggtcgcccacccgggcctcgtggcgatc
gcaatggaagagttcgtcaaggtgctcggcgacaagccgaaccagatcggcaagcaacgc
gacgacgtgctcgtcacggcgaccgacctgctcgacttccgtcctgaaacgccgatcacc
gagaacggtctgcgcaacaacatcaacgtcggcattcactacctgggagcctggctcacg
ggcaatggctgcgtgccgatccacaacctgatggaagatgccgccaccgcggaaatctcg
cgctcgcaggtgtggcaatggattcgctcgccgaagggcaagctcgatgacggccgcaag
gtcacggccgagctggtgcgcgcgatgtcggcgcaggaactcgacaaggtgaagcaggcc
gtgggcggcgatacgaaaccgtatgagcgcgccgcgcagatcttcgaggaaatgtcgacg
tcggagcagttcaccgacttcctgacgttgccgttgtacgaggagatctga

DBGET integrated database retrieval system