KEGG   Burkholderia xenovorans: Bxe_A1647Help
Entry
Bxe_A1647         CDS       T00340                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bxe  Burkholderia xenovorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bxe01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bxe00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bxe00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3089740..3091350
Genome map
AA seq 536 aa AA seqDB search
MANPQSPHATLQLPQGMEITAEIKPGYDAILTREALELVAALHRTFEPRRQQLLQARAER
TKRLDAGERPDFLAETKSVREGDWKIAPLPQDLQCRRVEITGPVERKMIINALNSGADSY
MTDFEDSNAPSWDNQITGHINLKDAVRRTISLEQNGKSYALNDKVATLIVRPRGWHLDEK
HVKVDGKRVSGSIFDFALFMVHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEA
VGVPRGTIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKSDRDFCL
ADRSQITMTSPFMRAYALLLLKTCHRRNAPAIGGMSALIPIRNDPAANDKAMAGVRSDKA
RDAGDGYDGGWVAHPGLVAIAMEEFVKVLGDKPNQIGKQRDDVLVTATDLLDFRPETPIT
ENGLRNNINVGIHYLGAWLTGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGKLDDGRK
VTAELVRAMSAQELDKVKQAVGGDTKPYERAAQIFEEMSTSEQFTDFLTLPLYEEI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacccgcagtcaccgcatgcaacgttgcagttgccgcaaggcatggaaatcacg
gctgagatcaagccgggctatgacgcgattctcacgcgcgaagcgctcgaactcgtcgcc
gcgctgcaccgcactttcgaaccgcgccgccagcaattgttgcaggcgcgcgcggaacgc
acgaagcgcctcgacgccggcgagcgtcccgacttcctcgccgaaacgaaaagcgtgcgt
gaaggcgactggaaaatcgcaccgctgccgcaggacttgcagtgccgtcgcgtggaaatc
accggcccggtggagcgcaagatgatcatcaacgcgctgaattcgggcgcggattcatac
atgacggacttcgaagattcgaatgcgccgagctgggataaccagatcaccggccatatc
aatctgaaggacgcggtgcgccgcacgatctcgctggagcagaacggcaagtcgtacgcg
ctgaacgacaaggtcgccacgctgatcgtgcgtccgcgcggctggcatctggatgagaag
cacgtaaaggtggacggcaagcgtgtgtcgggcagcatcttcgacttcgcgctcttcatg
gtgcacaacgcgaaggaactgctcgcgcgcggctcgggcccgtacttctatctgccgaag
atggagagccatctcgaagcgcgcctgtggaacgacatcttcgtggccgcgcaggaagcg
gtcggcgtgccgcgcggcacgattcgcgcgacggtgctgatcgaaacgatcctcgccgcg
ttcgaaatggacgagatcctgtacgagctgcgcgaacacagctcgggcctgaacgccggc
cgctgggactacatcttctcggcgatcaagaaattcaagtccgaccgtgatttctgcctg
gccgaccgctcgcagatcaccatgacctcgccgttcatgcgcgcctatgcgctgctgttg
ctgaagacctgccatcgccgcaatgcgccggcgatcggcggcatgagcgcgctgattccg
atcaggaacgatccggctgcgaacgacaaggcaatggccggcgtacgctcggacaaggcg
cgcgatgccggcgacggctacgacggcggctgggtcgcccacccgggcctcgtggcgatc
gcaatggaagagttcgtcaaggtgctcggcgacaagccgaaccagatcggcaagcaacgc
gacgacgtgctcgtcacggcgaccgacctgctcgacttccgtcctgaaacgccgatcacc
gagaacggtctgcgcaacaacatcaacgtcggcattcactacctgggagcctggctcacg
ggcaatggctgcgtgccgatccacaacctgatggaagatgccgccaccgcggaaatctcg
cgctcgcaggtgtggcaatggattcgctcgccgaagggcaagctcgatgacggccgcaag
gtcacggccgagctggtgcgcgcgatgtcggcgcaggaactcgacaaggtgaagcaggcc
gtgggcggcgatacgaaaccgtatgagcgcgccgcgcagatcttcgaggaaatgtcgacg
tcggagcagttcaccgacttcctgacgttgccgttgtacgaggagatctga

DBGET integrated database retrieval system