KEGG   Burkholderia xenovorans: Bxe_A1651Help
Entry
Bxe_A1651         CDS       T00340                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bxe  Burkholderia xenovorans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A1651
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_A1651
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bxe_A1651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3085577..3086881
Genome map
AA seq 434 aa AA seqDB search
MSRQEQAKQLQQQWETDPRWKGVKRSYTAEDVIRLRGSVQVEHTLAKRGAQKLWESVNNE
PFVNSLGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYIDYFAPIVADAEAGFGGVLNAFELMKAMIEAGAAGV
HFEDQLASVKKCGHMGGKVLVPTRENIAKLTAARLAADVSGVPTVLLARTDAEAADLITS
DIDENDKPFLTGERTVEGFYRTKPGLEQAISRGLAYAPYADMIWCETGKPDLEFAKKFAD
AIHKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARNQMTAFVEMQQAEFAAAEKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDKRVA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtcaggaacaagccaaacaacttcagcagcaatgggaaacggatccgcgctgg
aaaggcgtgaagcgcagctacacggcggaagacgtgatccgcctgcgcggttcggtgcag
gtcgagcacacgctcgccaagcgcggcgcgcaaaagctgtgggaaagcgtgaacaacgag
ccgttcgtcaactcgctcggcgcgctgaccggcaaccaggccatgcaacaggtcaaggcc
ggcctcaaggcgatctatctgtccggctggcaagtcgcgggcgacgcgaacgtggccggg
gaaatgtatccggaccagtcgctgtatccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctgacgcgtgccgaccagatccagtggtcggaaggcaagaacccgggc
gacgaaggctatatcgactacttcgcgccgatcgtggcggatgcggaagcgggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaagcgggcgctgccggcgtg
cacttcgaagaccagctcgcctccgtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaaaacatcgccaagctgaccgccgcgcgtctggccgccgacgtctcg
ggcgtgccgaccgtgctgctggcgcgtaccgatgcggaagccgccgacctgatcacctcg
gacatcgacgaaaacgacaagccgttcctgaccggcgagcgcacggtggaaggcttctac
cgcacgaagccgggtctcgaacaggcaatctcgcgtggcctcgcctacgcgccgtacgcc
gacatgatctggtgcgaaaccggcaagccggacctcgagttcgcgaagaaattcgccgac
gcgatccacaaggaatacccggatcaactgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctggacgacgcaacgatcgccaagttccagcgcgaactcggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccacgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcaaccagatgaccgccttcgtcgaaatgcagcaggct
gaattcgctgcggccgaaaagggcttcaccgcagtcaagcaccagcgcgaagtcggcacc
ggctacttcgatgccgtgacgcaaacggtcgaacgcgaagcatcgacgaccgcgctgcac
ggctcgacggaagacgaacagttcttcgacaagcgggtcgcgtaa

DBGET integrated database retrieval system