KEGG   Burkholderia xenovorans: Bxe_A1668Help
Entry
Bxe_A1668         CDS       T00340                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bxe  Burkholderia xenovorans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bxe01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bxe00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3065768..3066973
Genome map
AA seq 401 aa AA seqDB search
MPAAVFNRQPAFFHFKVACIESMSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFE
HETIESNGVTNLWAVKRGVDGTAGKLLAFAGHTDVVPTGPLEQWHSAPFEPTHRDGKLYG
RGAADMKASIAGFVVASEEFVAAHPAHRGSIAFLITSDEEGPATDGTIKVVEALQARGER
MDYCIVGEPTSSARLGDMVKNGRRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAEL
VAERWDDGNEYFPPTTWQVSNIHSGTGATNVIAGHADVMFNFRFSTASTVEGLQARVHAI
LDKHKLDYDLQWTVSGLPFLTPRGDLSNALAAAIRDETGVTTELSTTGGTSDGRFIARIC
PQVIEFGPLNASIHKTDEHIEVAHIEPLKNVYRRVLEQLIA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgccggctgcggtgttcaaccgccagccggcattttttcatttcaaagtggcttgtatc
gaatccatgtccggcaccctcgcccttaccgaacaactgatcgcgcgcgcgtccgtcacg
cccgacgaccagcattgccagcgcctcctgatcgaacgcctggccgcgctcggcttcgag
cacgagacgatcgaatcgaacggcgtcaccaatctgtgggccgtcaaacgcggcgtcgac
ggcaccgcgggcaagctgctcgcgttcgccggccataccgacgtggtgccgaccggcccg
ctcgaacaatggcactcggcgccgttcgagccgacccatcgcgacggcaagctgtacggc
cgcggcgcggcggacatgaaagcgtcgatcgcgggcttcgtggtggcgagcgaggagttc
gtcgccgcgcacccggcgcaccgcggctcgatcgccttcctgatcacgagcgacgaagaa
ggccccgccaccgacggcaccatcaaggtcgtcgaggccttgcaggcgcgcggcgagcgc
atggactactgcatcgtcggcgaaccgacgtcgagtgcgcggctcggcgacatggtgaag
aacggccggcgcggctcgatgtcgggcaagctgatcgtcaagggcgtgcaaggccatatc
gcctatccgcatctggcgaaaaatccggtgcatctgctcgcgcccgcgctcgccgagctg
gtcgccgagcgctgggacgacggcaacgaatatttcccgcccaccacgtggcaggtgtcg
aacattcacagcggcaccggggcgaccaacgtgattgccggccatgcggacgtgatgttc
aacttccgcttctcgacggcgagcacggtggaagggttgcaggcccgcgtccacgcgatc
ctcgacaaacacaagctcgactacgatctgcaatggaccgtgagcggcctgccgttcctc
acgccgcgcggcgatctgtcgaacgcgctcgccgcggcgatcagggacgaaaccggcgtc
accaccgaactgtcgaccaccggcggcacctcggacggccgcttcattgcgcgcatctgc
ccgcaggtgatcgaattcggcccgctgaacgccagcatccacaagaccgacgaacatatc
gaagtcgcacacatcgagccgctgaagaacgtgtatcgccgcgtgctcgaacaactgatt
gcgtga

DBGET integrated database retrieval system