KEGG   Burkholderia xenovorans LB400: Bxe_A1668Help
Entry
Bxe_A1668         CDS       T00340                                 

Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bxe_A1668
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bxe_A1668
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bxe_A1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3065768..3066973
Genome map
AA seq 401 aa AA seqDB search
MPAAVFNRQPAFFHFKVACIESMSGTLALTEQLIARASVTPDDQHCQRLLIERLAALGFE
HETIESNGVTNLWAVKRGVDGTAGKLLAFAGHTDVVPTGPLEQWHSAPFEPTHRDGKLYG
RGAADMKASIAGFVVASEEFVAAHPAHRGSIAFLITSDEEGPATDGTIKVVEALQARGER
MDYCIVGEPTSSARLGDMVKNGRRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAEL
VAERWDDGNEYFPPTTWQVSNIHSGTGATNVIAGHADVMFNFRFSTASTVEGLQARVHAI
LDKHKLDYDLQWTVSGLPFLTPRGDLSNALAAAIRDETGVTTELSTTGGTSDGRFIARIC
PQVIEFGPLNASIHKTDEHIEVAHIEPLKNVYRRVLEQLIA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgccggctgcggtgttcaaccgccagccggcattttttcatttcaaagtggcttgtatc
gaatccatgtccggcaccctcgcccttaccgaacaactgatcgcgcgcgcgtccgtcacg
cccgacgaccagcattgccagcgcctcctgatcgaacgcctggccgcgctcggcttcgag
cacgagacgatcgaatcgaacggcgtcaccaatctgtgggccgtcaaacgcggcgtcgac
ggcaccgcgggcaagctgctcgcgttcgccggccataccgacgtggtgccgaccggcccg
ctcgaacaatggcactcggcgccgttcgagccgacccatcgcgacggcaagctgtacggc
cgcggcgcggcggacatgaaagcgtcgatcgcgggcttcgtggtggcgagcgaggagttc
gtcgccgcgcacccggcgcaccgcggctcgatcgccttcctgatcacgagcgacgaagaa
ggccccgccaccgacggcaccatcaaggtcgtcgaggccttgcaggcgcgcggcgagcgc
atggactactgcatcgtcggcgaaccgacgtcgagtgcgcggctcggcgacatggtgaag
aacggccggcgcggctcgatgtcgggcaagctgatcgtcaagggcgtgcaaggccatatc
gcctatccgcatctggcgaaaaatccggtgcatctgctcgcgcccgcgctcgccgagctg
gtcgccgagcgctgggacgacggcaacgaatatttcccgcccaccacgtggcaggtgtcg
aacattcacagcggcaccggggcgaccaacgtgattgccggccatgcggacgtgatgttc
aacttccgcttctcgacggcgagcacggtggaagggttgcaggcccgcgtccacgcgatc
ctcgacaaacacaagctcgactacgatctgcaatggaccgtgagcggcctgccgttcctc
acgccgcgcggcgatctgtcgaacgcgctcgccgcggcgatcagggacgaaaccggcgtc
accaccgaactgtcgaccaccggcggcacctcggacggccgcttcattgcgcgcatctgc
ccgcaggtgatcgaattcggcccgctgaacgccagcatccacaagaccgacgaacatatc
gaagtcgcacacatcgagccgctgaagaacgtgtatcgccgcgtgctcgaacaactgatt
gcgtga

DBGET integrated database retrieval system