KEGG   Burkholderia xenovorans LB400: Bxe_A1730Help
Entry
Bxe_A1730         CDS       T00340                                 

Definition
zinc-containing alcohol dehydrogenase superfamily protein (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bxe_A1730
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A1730
  Lipid metabolism
   00071 Fatty acid degradation
    Bxe_A1730
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_A1730
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bxe_A1730
   00626 Naphthalene degradation
    Bxe_A1730
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bxe_A1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2995805..2996905)
Genome map
AA seq 366 aa AA seqDB search
MKAALLNAFGTPLSIETLPDPVIGTGEVIVDVVATGVASYAHGVFSGARNYLLEPPLVPG
AGAIGRVRAVGPDSTRLAVGDWVYCDPTIRARDNAINPDTILQGWTARNPAALSLHRFYH
HGSFATQMLVPTENVTAIGDLEERDAGKWCALSQLLVPFGGLLAGELQPGDTVLVNGATG
GFGSAGVVAALAMGAAKVVAAGRNQHKLDELARLLGPRVSCVRMTGDVDDTRRICELAEG
EIDLALDILPRGASASQVLAGAKALRRGGRLVLMGGVRKTGDDEPALPYAWLMHNEVTLR
GQWMYPRVAIPQMVSMIRAGLVSLTKFNVTEFALDDANEAVAFAADNAGPLSLVVISPCR
RKYTHG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctcttctcaatgcattcggtactccgctctccatcgaaacattacccgat
ccggttattggaacaggcgaagtcatcgttgacgtcgtcgcgacaggagtggcgagctat
gcacacggcgtcttctccggcgcccggaattacctgctggagccgccgctcgtgccgggt
gctggcgctataggccgggtgcgtgcggtgggtccggattccacacggctcgcagttggc
gactgggtctactgtgacccgaccattcgcgcgcgtgacaatgccattaacccggacacg
attctgcaaggatggaccgcacgtaatccggcggccctttctctgcatcgcttctatcac
cacggttcctttgcgacgcagatgctggtgccgaccgagaatgtcacggctattggtgat
ctggaagagcgcgatgcggggaagtggtgcgcgttgagccaattgctggtgccgttcggc
ggtctgctcgctggagagctgcagcctggcgataccgtgcttgtcaacggggcaacggga
ggattcggcagcgccggagtcgtcgcggcgctcgctatgggcgcggcaaaagttgtggcc
gctggtcgtaatcagcacaagctcgatgaactggctcgtctgctcggtccgcgggtgagt
tgcgtacgcatgacaggagacgtagacgatacacgacgaatctgcgaactcgcggaaggg
gagatagacctcgcgttggacatattgccccgtggggcgtctgcgtcgcaggtgctggcg
ggtgcgaaggcgctcaggcgtggtggccgcttggtgctcatggggggagtcaggaagacc
ggagacgacgagcctgcactgccatatgcctggcttatgcacaatgaagtcacgcttcga
ggtcaatggatgtacccgcgtgtggcgatcccgcaaatggtttcaatgattcgtgccggg
ctggtcagcctgacgaagttcaacgtcaccgaatttgctttggacgatgccaatgaagcg
gttgccttcgcagccgataacgctggtccgctctcgctggtcgtgatcagtccctgcagg
cgaaaatatactcatggctag

DBGET integrated database retrieval system