KEGG   Burkholderia xenovorans LB400: Bxe_A2223Help
Entry
Bxe_A2223         CDS       T00340                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A2223
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_A2223
   00630 Glyoxylate and dicarboxylate metabolism
    Bxe_A2223
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bxe_A2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2459354..2461528)
Genome map
AA seq 724 aa AA seqDB search
MTQMNPRGGLQVAANLDQFVETEALPGTGLDSAAFWSGFDALVHELAPKNRALLAERDRL
QTELDNWHRANPGPVRDLRAYRAFLEGIGYIVPVPASVKATTDHVDTEIAEQAGPQLVVP
LSNQRYALNAANARWGSLYDALYGTDAIPEANGAEKQKAFNPVRGAAVIAYARRFLDQAA
PLANGSHADATRYGVEGGKLVVTLKNGTSELKTPAQFIGYQGEESAPSAVLLKHNGLHFE
IQIDANDSIGKTDSAHVKDVVVEAAVSTIIDCEDSVAAVDADDKVQLYRNWLGLMNGDLT
EEVTKNGKTFTRRLNADRVYTAANGTAPVVLHGRSLLFIRNVGHLMTNPAVLTKDGHEIP
EGILDAVITSLCALHDRKHKLNSRTGSIYIVKPKMHGPAEVAFASELFARVEDLLKLPRN
TIKMGIMDEERRTSVNLLACINEARERVAFINTGFLDRTGDEMHTAMEAGPMLRKGDMKS
SAWIAAYERSNVLVGLSAGLRGRSQIGKGMWAMPDLMHAMLEQKIAHPKAGANTAWVPSP
TAATLHALHYHQVDVQAVQQELERTDYAKVRDELLDGLLTIPVVAEAKWSDDEIRSEIDN
NAQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLYHGVVKRELVEE
TFRRMARVVDEQNAGDPLYKPMAPGFDTIAFKAAQALVFEGRQQPSGYTEPLLHKFRLEV
KKEA
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgactcagatgaacccgcgcggcggactgcaagtcgccgccaacctcgaccagttcgtc
gaaaccgaagccctgcccggcaccggactcgacagcgctgcattctggtcgggtttcgac
gccctcgtgcacgagctggcgcccaaaaaccgtgcgttgctcgccgaacgcgaccgcctg
cagaccgaactggacaactggcatcgcgccaatccgggtccggtgcgcgatctgcgtgcg
taccgcgcgtttctcgaaggcatcggctatatcgtgccagtgcccgccagcgtcaaagcc
acgaccgaccacgtggacaccgaaatcgccgaacaggccggcccgcaactcgtggtgccg
ctgtcgaatcaacgctacgcgctgaacgccgcgaacgcgcgctggggcagcctgtacgac
gcgctgtacggcaccgacgcgattcccgaggccaatggcgccgaaaagcagaaggcgttc
aacccggtgcgcggcgccgcggtgatcgcctatgcgcgcaggtttctcgatcaggccgcg
ccgctcgcgaacggctcgcatgccgacgcgacgcgctatggcgtcgaaggcggcaagctg
gtcgtcacgctgaagaacggcacgagcgagctgaagacgcccgcgcaattcatcggctat
cagggtgaagagagcgcgccgtccgccgtgctgctcaagcacaacggcctgcacttcgaa
atccagatcgatgcgaacgactcgatcggcaagaccgattcggcgcatgtgaaggacgtg
gtggtcgaagcggcggtgagcacgatcatcgactgcgaagattcggtcgcggccgtggac
gcggacgacaaggtccagctctaccgcaactggctcggcctgatgaacggcgacctgacc
gaagaggtcacgaagaacggcaagaccttcacgcgccggctgaacgccgaccgcgtctac
acggcggcgaacggcacggcgccggtcgtgctgcatggccgctcgctgctgttcatccgg
aatgtgggtcatttgatgaccaatccggcggtgctgaccaaagacggccacgagattccg
gaaggcattctcgacgcggtgatcacctcgctgtgcgcgttgcacgaccgcaagcacaag
ctgaattcgcgcaccggctcgatttatatcgtcaaacccaagatgcacggtccggccgaa
gtcgccttcgccagcgagttgttcgcgcgcgtggaagacctgctgaagctgccgcgcaac
acgatcaagatgggcatcatggacgaggagcgccgcaccagcgtgaacctgctcgcctgt
atcaacgaagcgcgggagcgcgtcgcgttcatcaacaccggtttcctcgaccgtaccggc
gacgagatgcacacggcaatggaagccggtccgatgctgcgcaaaggcgacatgaaatcg
agcgcctggattgcggcttacgagcgcagcaacgtgctggttggtttgagcgcaggcctg
cgcggccgctcgcaaatcggcaagggcatgtgggccatgcccgacctgatgcacgcaatg
ctcgaacagaagatcgcgcatccgaaagccggcgcgaacaccgcgtgggtgccctcgccg
accgccgcgacgctgcatgccttgcactatcaccaggtcgacgtgcaagcggttcagcag
gaactggagcgcacggattatgcgaaggtgcgagacgaactgctcgacggcctgctgacc
attcccgtggtggccgaggcaaagtggagcgacgacgagatccgcagcgagatcgacaac
aacgcgcaggggattcttggctacgtggtgcgctggatcgaccagggcgtgggttgttcg
aaggtgccggacattcacaatgtcggcctgatggaagaccgtgccacgctgcgtatttcc
agccagcacattgccaactggctgtatcacggcgtggtgaagcgcgagctggttgaagag
acgttcaggcgcatggccagggtggtcgacgagcagaacgccggcgacccgctctacaag
ccgatggcgccgggcttcgatacgatcgccttcaaggccgcgcaagcgctggtattcgaa
ggacgccagcagccgagcggctatacggaaccgttgctgcataagttccggctggaagtg
aagaaggaggcttga

DBGET integrated database retrieval system