KEGG   Burkholderia xenovorans LB400: Bxe_A2225Help
Entry
Bxe_A2225         CDS       T00340                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bxe_A2225
   00052 Galactose metabolism
    Bxe_A2225
   00500 Starch and sucrose metabolism
    Bxe_A2225
   00520 Amino sugar and nucleotide sugar metabolism
    Bxe_A2225
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bxe_A2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2457643..2458560
Genome map
AA seq 305 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARNKQKLLDLVRSIKPANVDCFYVRQAEALGLGHAVLCAEK
LVGDSPFAVILADDLLHSSKPVMSQLVDTFNHYHSSVIGVETIAREDSRSYGVVDGREWE
DNVIKLSGIVEKPAPDKAPSNLGVVGRYVLMPTIFKHIRALKPGAGGELQLTDAVQSLLT
EEQVLAYRYFGTRFDCGSKLGYLKATVEFALRHPEVKAEFEAYLQAYMQTNMQEGVPAQY
AAEAA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaagtcaccaaagccgtgtttcccgtagcgggcctcgggacacgattcctgccg
gctaccaaagcgagtccaaaggaaatgctgccgatcgtggacaagccgctgattcaatac
gcggttgaagaagcgattgccgccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgccattgaagatcatttcgacaagtcctacgagatcgaagccgaactcgaggcg
cgtaacaagcagaagctgctcgatctggtgcgcagcatcaagccggccaatgtcgactgt
ttctatgtgcgccaggccgaagcgctcggtctcggccatgcggtgctgtgcgccgagaaa
ctggtgggcgacagcccgttcgccgtgattctggccgacgacctgctgcacagctcgaag
ccggtaatgagccagcttgtcgatacgttcaaccactatcacagctcggtgatcggcgtg
gaaaccatcgcgcgcgaagacagccgctcgtacggcgtggtggacggccgcgaatgggaa
gacaacgtgatcaagctgtcgggcatagtcgagaagccggcgccggacaaggcaccgtcg
aatctcggcgtggtgggccgctatgtgctgatgccgaccatcttcaagcatatccgcgcg
ttgaagccgggtgcgggcggcgagttgcaattgaccgacgcggtgcaatcgctgctgacc
gaagagcaggtgcttgcgtatcgctatttcggcacgcgtttcgattgcggcagcaagctg
ggctatctgaaggcgacggtggaattcgcgctgcgtcatccggaagtgaaggcggaattc
gaagcgtatttgcaggcgtatatgcagaccaacatgcaggaaggtgtgccggcgcagtat
gcggcggaagcggcttga

DBGET integrated database retrieval system