KEGG   Paraburkholderia xenovorans LB400: Bxe_A2352Help
Entry
Bxe_A2352         CDS       T00340                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bxe  Paraburkholderia xenovorans LB400
Brite
Enzymes [BR:bxe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bxe_A2352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 NodS Methyltransf_23 Methyltransf_11 RrnaAD
Motif
Other DBs
NCBI-ProteinID: ABE30618
JGI: BxeA2352
UniProt: Q13Z71
Position
1:2307855..2308814
Genome map
AA seq 319 aa AA seqDB search
MKNSPPGSAGKSQSRQANAQTAAPAKPQARPSAATPPKPLAAPSAKAPVKAPLQAPLNAS
VKAPARSAAQNSTARPSPQPAASAKPAARATERSAAPNVALNGALALTSERVRERMVERL
RANGVTDQRVLNAMSVVPRHMFVDPGLAAQAYEDAALPIGHHQTISKPSVVARMIELAAA
GRALNNVLEIGTGCGYQAAVLSQVAREVYSIERIRPLSERAKTNLRPLRIPNIRLHYGDG
RLGLPSAAPFDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGSQEGQSQVLTLVERLGPAQ
WRESRLDRVFFVPLKSGVI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaactcgccgcccgggtccgcgggtaagtcccagtcccggcaggcgaatgcgcaa
actgcggcgccggcgaagccgcaggcgaggccatccgcggcaactccgccgaagccactg
gcggcgccttccgccaaagcgccggtgaaagcaccgctacaagcaccgctgaatgcatcg
gtgaaagcgccggccaggagcgccgcgcagaattccaccgcgcgtccctcgccgcagccg
gcggcatccgccaaacctgcggcccgcgccaccgagcgcagcgccgcgccgaacgttgct
ttgaacggcgcattggcgctgacttcggaacgggttcgcgaacggatggtcgaacgcctg
cgtgcgaacggtgtgaccgatcagcgcgtgttgaacgcgatgtcggtcgtgccgcgccat
atgttcgtcgacccgggtctcgcggcgcaggcctacgaagatgccgcattgccgatcggt
catcaccagacgatctccaaaccctcggtcgtggcccggatgatcgaactggccgccgcc
ggccgcgcgctgaacaacgtgctcgaaatcggcacgggctgcggttatcaggcggccgtg
ctgagccaggtcgcgcgcgaggtttactcgatcgagcgcatcaggccgctgtcggagcgc
gccaagacaaatttgcgtccgctgcgcattccgaacatccggctgcactatggagacggg
cggttgggtctgccctcggcggcaccgttcgacgcgatcgtgatcgccgcggcggggctc
gacgtaccgcaagcgttacttgaacaactcgcgatcggcggccgcctggtcgcgccggtc
ggctcgcaggagggccaaagccaggtgctgactctggtcgagcgcctcggacccgcgcag
tggcgcgagtcgcggcttgatcgcgttttctttgtacccttaaaatccggagtgatttga

DBGET integrated database retrieval system