KEGG   Burkholderia xenovorans: Bxe_A2352Help
Entry
Bxe_A2352         CDS       T00340                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bxe  Burkholderia xenovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2307855..2308814
Genome map
AA seq 319 aa AA seqDB search
MKNSPPGSAGKSQSRQANAQTAAPAKPQARPSAATPPKPLAAPSAKAPVKAPLQAPLNAS
VKAPARSAAQNSTARPSPQPAASAKPAARATERSAAPNVALNGALALTSERVRERMVERL
RANGVTDQRVLNAMSVVPRHMFVDPGLAAQAYEDAALPIGHHQTISKPSVVARMIELAAA
GRALNNVLEIGTGCGYQAAVLSQVAREVYSIERIRPLSERAKTNLRPLRIPNIRLHYGDG
RLGLPSAAPFDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGSQEGQSQVLTLVERLGPAQ
WRESRLDRVFFVPLKSGVI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaactcgccgcccgggtccgcgggtaagtcccagtcccggcaggcgaatgcgcaa
actgcggcgccggcgaagccgcaggcgaggccatccgcggcaactccgccgaagccactg
gcggcgccttccgccaaagcgccggtgaaagcaccgctacaagcaccgctgaatgcatcg
gtgaaagcgccggccaggagcgccgcgcagaattccaccgcgcgtccctcgccgcagccg
gcggcatccgccaaacctgcggcccgcgccaccgagcgcagcgccgcgccgaacgttgct
ttgaacggcgcattggcgctgacttcggaacgggttcgcgaacggatggtcgaacgcctg
cgtgcgaacggtgtgaccgatcagcgcgtgttgaacgcgatgtcggtcgtgccgcgccat
atgttcgtcgacccgggtctcgcggcgcaggcctacgaagatgccgcattgccgatcggt
catcaccagacgatctccaaaccctcggtcgtggcccggatgatcgaactggccgccgcc
ggccgcgcgctgaacaacgtgctcgaaatcggcacgggctgcggttatcaggcggccgtg
ctgagccaggtcgcgcgcgaggtttactcgatcgagcgcatcaggccgctgtcggagcgc
gccaagacaaatttgcgtccgctgcgcattccgaacatccggctgcactatggagacggg
cggttgggtctgccctcggcggcaccgttcgacgcgatcgtgatcgccgcggcggggctc
gacgtaccgcaagcgttacttgaacaactcgcgatcggcggccgcctggtcgcgccggtc
ggctcgcaggagggccaaagccaggtgctgactctggtcgagcgcctcggacccgcgcag
tggcgcgagtcgcggcttgatcgcgttttctttgtacccttaaaatccggagtgatttga

DBGET integrated database retrieval system