KEGG   Burkholderia xenovorans: Bxe_A2359Help
Entry
Bxe_A2359         CDS       T00340                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bxe  Burkholderia xenovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bxe_A2359 (recR)
DNA repair and recombination proteins [BR:bxe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bxe_A2359 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2300749..2301345
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRALPGVGPKSAQRMAYHLMQHDRDGAEKLGRSLLFATEHLQHCEKC
NTFTEAQICEVCLDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRSM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaccttccgccttgtcggcgctcgtcgaagcgctgcgcgcgctgcctggcgtc
gggccgaagtccgcgcaacgcatggcgtaccacctgatgcagcacgaccgcgacggcgcc
gaaaaactcggccgctcgctgctgttcgccaccgagcatctgcagcactgcgagaagtgc
aacaccttcaccgaagcgcagatctgcgaggtctgcctcgacgaggagcgcgatcccacc
ttgctgtgcgtcgtcgaaacgcctgccgaccagatcatgctcgagcagaccatgacctat
cgcggtctttatttcgtgctgatggggcgcctgagtccgctcgacggtatcggtccgaag
gagattcatttcgaccggctcgtccggcgcgcgtcggacggcgtggtcaaggaagtggtg
ctcgcaaccaatttcaccaacgaaggcgaagcgaccgcgcattacctcgggcagacgctc
aaggcgcgcggcctcgccgtcacgcgtcttgcgcgcggcgtgccggtgggtggcgaactg
gagtacgtggacgccggcacgatcgcccgcgccatgctcgatcgccgctcgatgtag

DBGET integrated database retrieval system