KEGG   Burkholderia xenovorans LB400: Bxe_A2380Help
Entry
Bxe_A2380         CDS       T00340                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bxe_A2380
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_A2380
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bxe_A2380
Enzymes [BR:bxe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bxe_A2380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2276786..2278237
Genome map
AA seq 483 aa AA seqDB search
MNYLSTRGAGAGEHHTFSDILLGGLAKDGGLYLPAEYPRITGDELTRWRTLPYADLAFEI
LSRFSDDIPAEDLRALTRKTYTAATYCNVRDDESAAQITPLKTLGVENGAPLSLLELSNG
PTLAFKDMAMQLIGNLFEYTLAKHGQTLNILGATSGDTGSAAEYAMRGKKGISVFMLSPH
RKMSAFQTAQMYSLQDPNIFNIAVEGVFDDAQDIVKAVSNDHAFKAKYRIGTVNSINWAR
VVAQVVYYFKGYFAATKSNDERVSFTVPSGNFGNVCAGHIARMMGLPIEKLVVATNENDV
LDEFFRTGIYRVRKAAETYHTSSPSMDISKASNFERFVFDLLGRDPARVLQLFRDVEEKG
GFDLAASGDFARVQQFGFVSGRSSHESRVETIRDVFERYDTMIDTHTADGLKVAREYLQP
GIPMIVLETAQPIKFGETIREALLREPERPAAFSGLESLPQRFEVLPADVQRVKDFIAAN
VDA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacctctccacgcgcggcgccggagccggcgagcaccataccttttccgacatc
ctgctgggcggtctcgcgaaagacggcggcctgtacctgcccgccgaatatccgcgcatc
accggcgacgaactgacgcgctggcgcacgctgccgtacgcggacctggccttcgagatc
ctgtcccgattcagcgacgacattcccgccgaagacctgcgcgcgctcacacgcaaaacg
tacaccgcggccacctactgcaacgtgcgcgacgacgaaagcgccgcgcagatcacgccg
ctgaagacgctcggcgtcgagaacggcgcgccgctgtcgctgctggaactctcgaacgga
ccgacgctcgcattcaaggacatggcgatgcagttgatcggcaacctgttcgaatacacg
ctggcaaagcacggtcaaacgctgaacattctcggcgcgacctcgggcgacaccggcagc
gccgcggaatacgcgatgcgcggcaagaaaggcatcagcgtgttcatgctctcgccgcac
aggaagatgagcgcgttccagaccgcgcagatgtacagcctgcaggatccgaacatcttc
aacatcgcggtggaaggcgtgttcgacgacgcgcaggacatcgtcaaggccgtctcgaac
gatcacgcattcaaggcgaagtacaggatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtattacttcaagggctactttgcggccacgaagtcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtgtgcgcgggtcacatc
gcgcgcatgatgggtttgccgatcgaaaagctggtcgtggcgacgaacgaaaacgacgtg
ctcgacgagtttttccgcaccggtatttaccgcgtgcgcaaggcggccgagacgtatcac
accagcagcccgagcatggacatttcgaaggcttcgaacttcgagcgtttcgtgttcgat
ctgctcggccgcgatccggcgcgcgtgctgcaactgttccgcgacgtcgaagagaagggc
ggtttcgacctcgccgcgagcggggactttgcgcgcgtgcagcaattcggtttcgtgtcg
ggccgcagcagccacgaatcgcgcgtggagaccatccgcgacgtgttcgagcgttacgac
acgatgatcgacacgcacacggccgacggactgaaggtcgcgcgcgaatatctgcagccg
ggcattccgatgatcgtgctggagaccgcgcaaccgatcaaattcggcgagacgatccgc
gaagcgctgctgcgcgaaccggagcggccggcggctttctcgggcctcgaatccctgccg
cagcgcttcgaagtgctgcccgcggacgttcagcgcgtgaaggactttatcgcggcgaac
gtggacgcgtaa

DBGET integrated database retrieval system