KEGG   Paraburkholderia xenovorans LB400: Bxe_A2650Help
Entry
Bxe_A2650         CDS       T00340                                 

Definition
(GenBank) Putative type IV secretion system protein VirB10
  KO
K03195  type IV secretion system protein VirB10
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe03070  Bacterial secretion system
Module
bxe_M00333  Type IV secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Bxe_A2650
Secretion system [BR:bxe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein [MD:M00333]
   Bxe_A2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI Mycobact_memb
Motif
Other DBs
NCBI-ProteinID: ABE30309
JGI: BxeA2650
UniProt: Q140D0
Position
1:2001112..2002344
Genome map
AA seq 410 aa AA seqDB search
MNDDTPRNLIEPDDSAGARPGRNPNDSASGASAARGMPAVGQYRSARTRAWWLTPIVIVL
VVGAGAVWTVHGFLARHDAEAKARRDSVADASSQGRVFKDLPASAIGAASGPVPTSIAVR
PVPASAVAVAPVGVTHAVTPRSYYDAPLLVSGGGQETAAALHGVLEAGGAAGVASSVAAA
VSGGAGAPSEVAGPAGGALAQALTPTATPRVRAGMLGNRSLVLAQGAKIDCVGDTAFDST
EAGISTCTVTKNVYSDDGRVVLIERGSQIDSQYRSNLSPGQKRVFMLSARVKTPHGVTVE
IDSPAADALGRMGMDGYVDNHWGQRIGAAMLLGLTQDAIGYLATRGGNSNGSVVYENTQQ
QGNDMATRVLDSTINIPPTLKQNQGAEFTIVVARDLDFGSVYTLQPEGAQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgataccccgagaaatctgattgagcccgacgattccgctggggcgcggccc
ggacgcaacccgaacgatagtgcatcaggggcatccgcggctcgcggaatgccggcggtg
ggccaataccgtagtgcccgcacgcgcgcctggtggctgacgccgatcgtgatcgttctg
gtcgtcggtgccggtgcggtctggaccgtccatggtttcctcgcgcgtcacgatgccgaa
gccaaggcacggcgcgattcggtggccgacgcgtcgagccagggccgggtgttcaaggat
cttcctgcgtccgccatcggtgcggcatccggtccggtgcctacgagcattgctgtacgc
cccgtaccggcttcggcagtggctgttgcgcctgttggcgtcacgcacgccgtgacgcct
cgtagctactacgacgcgcccctgctggtctcgggcggcgggcaggagacggcagctgcg
ttgcacggtgtgctggaggcgggtggcgcggcaggtgttgcatcgtcggtggccgcagca
gtatccggtggcgcaggcgccccatcagaggtggcgggaccggcaggaggcgcgcttgcc
caggcgttgacgccgactgcgacccctcgtgtgcgtgccggcatgctcggcaaccgcagt
ctggtgctcgcgcagggcgccaagatcgactgcgtgggcgatacggccttcgattcgacc
gaggccggcatctcgacctgcacggtcacgaagaacgtgtactccgacgatggtcgcgtg
gtgctgatcgagcgcggttcgcagatcgacagccagtaccggtcgaacctgtcgccgggc
cagaagcgagtgttcatgttgtcggcacgtgtcaagacgccgcacggcgtcacggtcgag
attgattcgcctgcagccgacgcactcggccgcatgggcatggacggttatgtggacaac
cactggggccagcgcattggtgccgcgatgctgctcggcctgacccaggacgcgatcggt
tatctggcgacgcgcggcggcaatagcaatggatccgtcgtgtacgagaacacgcagcag
cagggcaacgacatggccacgcgcgtactcgacagcacgatcaacattccgccgacgctg
aagcagaaccagggcgcggagttcacgatcgtggtcgcgcgcgatctcgacttcggatcg
gtctatacgctgcagccggaaggtgcgcaatga

DBGET integrated database retrieval system