KEGG   Burkholderia xenovorans: Bxe_A2650Help
Entry
Bxe_A2650         CDS       T00340                                 

Definition
type IV secretion system protein VirB10
Orthology
K03195  
type IV secretion system protein VirB10
Organism
bxe  Burkholderia xenovorans
Pathway
Bacterial secretion system
Module
Type IV secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Bxe_A2650
Secretion system [BR:bxe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer protein [MD:M00333]
   Bxe_A2650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2001112..2002344
Genome map
AA seq 410 aa AA seqDB search
MNDDTPRNLIEPDDSAGARPGRNPNDSASGASAARGMPAVGQYRSARTRAWWLTPIVIVL
VVGAGAVWTVHGFLARHDAEAKARRDSVADASSQGRVFKDLPASAIGAASGPVPTSIAVR
PVPASAVAVAPVGVTHAVTPRSYYDAPLLVSGGGQETAAALHGVLEAGGAAGVASSVAAA
VSGGAGAPSEVAGPAGGALAQALTPTATPRVRAGMLGNRSLVLAQGAKIDCVGDTAFDST
EAGISTCTVTKNVYSDDGRVVLIERGSQIDSQYRSNLSPGQKRVFMLSARVKTPHGVTVE
IDSPAADALGRMGMDGYVDNHWGQRIGAAMLLGLTQDAIGYLATRGGNSNGSVVYENTQQ
QGNDMATRVLDSTINIPPTLKQNQGAEFTIVVARDLDFGSVYTLQPEGAQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgataccccgagaaatctgattgagcccgacgattccgctggggcgcggccc
ggacgcaacccgaacgatagtgcatcaggggcatccgcggctcgcggaatgccggcggtg
ggccaataccgtagtgcccgcacgcgcgcctggtggctgacgccgatcgtgatcgttctg
gtcgtcggtgccggtgcggtctggaccgtccatggtttcctcgcgcgtcacgatgccgaa
gccaaggcacggcgcgattcggtggccgacgcgtcgagccagggccgggtgttcaaggat
cttcctgcgtccgccatcggtgcggcatccggtccggtgcctacgagcattgctgtacgc
cccgtaccggcttcggcagtggctgttgcgcctgttggcgtcacgcacgccgtgacgcct
cgtagctactacgacgcgcccctgctggtctcgggcggcgggcaggagacggcagctgcg
ttgcacggtgtgctggaggcgggtggcgcggcaggtgttgcatcgtcggtggccgcagca
gtatccggtggcgcaggcgccccatcagaggtggcgggaccggcaggaggcgcgcttgcc
caggcgttgacgccgactgcgacccctcgtgtgcgtgccggcatgctcggcaaccgcagt
ctggtgctcgcgcagggcgccaagatcgactgcgtgggcgatacggccttcgattcgacc
gaggccggcatctcgacctgcacggtcacgaagaacgtgtactccgacgatggtcgcgtg
gtgctgatcgagcgcggttcgcagatcgacagccagtaccggtcgaacctgtcgccgggc
cagaagcgagtgttcatgttgtcggcacgtgtcaagacgccgcacggcgtcacggtcgag
attgattcgcctgcagccgacgcactcggccgcatgggcatggacggttatgtggacaac
cactggggccagcgcattggtgccgcgatgctgctcggcctgacccaggacgcgatcggt
tatctggcgacgcgcggcggcaatagcaatggatccgtcgtgtacgagaacacgcagcag
cagggcaacgacatggccacgcgcgtactcgacagcacgatcaacattccgccgacgctg
aagcagaaccagggcgcggagttcacgatcgtggtcgcgcgcgatctcgacttcggatcg
gtctatacgctgcagccggaaggtgcgcaatga

DBGET integrated database retrieval system