KEGG   Burkholderia xenovorans: Bxe_A2650Help
Entry
Bxe_A2650         CDS       T00340                                 

Definition
type IV secretion system protein VirB10
Orthology
K03195  
type IV secretion system protein VirB10
Organism
bxe  Burkholderia xenovorans
Pathway
Bacterial secretion system
Class
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:bxe03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2001112..2002344
Genome map
AA seq 410 aa AA seqDB search
MNDDTPRNLIEPDDSAGARPGRNPNDSASGASAARGMPAVGQYRSARTRAWWLTPIVIVL
VVGAGAVWTVHGFLARHDAEAKARRDSVADASSQGRVFKDLPASAIGAASGPVPTSIAVR
PVPASAVAVAPVGVTHAVTPRSYYDAPLLVSGGGQETAAALHGVLEAGGAAGVASSVAAA
VSGGAGAPSEVAGPAGGALAQALTPTATPRVRAGMLGNRSLVLAQGAKIDCVGDTAFDST
EAGISTCTVTKNVYSDDGRVVLIERGSQIDSQYRSNLSPGQKRVFMLSARVKTPHGVTVE
IDSPAADALGRMGMDGYVDNHWGQRIGAAMLLGLTQDAIGYLATRGGNSNGSVVYENTQQ
QGNDMATRVLDSTINIPPTLKQNQGAEFTIVVARDLDFGSVYTLQPEGAQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgataccccgagaaatctgattgagcccgacgattccgctggggcgcggccc
ggacgcaacccgaacgatagtgcatcaggggcatccgcggctcgcggaatgccggcggtg
ggccaataccgtagtgcccgcacgcgcgcctggtggctgacgccgatcgtgatcgttctg
gtcgtcggtgccggtgcggtctggaccgtccatggtttcctcgcgcgtcacgatgccgaa
gccaaggcacggcgcgattcggtggccgacgcgtcgagccagggccgggtgttcaaggat
cttcctgcgtccgccatcggtgcggcatccggtccggtgcctacgagcattgctgtacgc
cccgtaccggcttcggcagtggctgttgcgcctgttggcgtcacgcacgccgtgacgcct
cgtagctactacgacgcgcccctgctggtctcgggcggcgggcaggagacggcagctgcg
ttgcacggtgtgctggaggcgggtggcgcggcaggtgttgcatcgtcggtggccgcagca
gtatccggtggcgcaggcgccccatcagaggtggcgggaccggcaggaggcgcgcttgcc
caggcgttgacgccgactgcgacccctcgtgtgcgtgccggcatgctcggcaaccgcagt
ctggtgctcgcgcagggcgccaagatcgactgcgtgggcgatacggccttcgattcgacc
gaggccggcatctcgacctgcacggtcacgaagaacgtgtactccgacgatggtcgcgtg
gtgctgatcgagcgcggttcgcagatcgacagccagtaccggtcgaacctgtcgccgggc
cagaagcgagtgttcatgttgtcggcacgtgtcaagacgccgcacggcgtcacggtcgag
attgattcgcctgcagccgacgcactcggccgcatgggcatggacggttatgtggacaac
cactggggccagcgcattggtgccgcgatgctgctcggcctgacccaggacgcgatcggt
tatctggcgacgcgcggcggcaatagcaatggatccgtcgtgtacgagaacacgcagcag
cagggcaacgacatggccacgcgcgtactcgacagcacgatcaacattccgccgacgctg
aagcagaaccagggcgcggagttcacgatcgtggtcgcgcgcgatctcgacttcggatcg
gtctatacgctgcagccggaaggtgcgcaatga

DBGET integrated database retrieval system