KEGG   Burkholderia xenovorans: Bxe_A2811Help
Entry
Bxe_A2811         CDS       T00340                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bxe  Burkholderia xenovorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A2811
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bxe_A2811
  Amino acid metabolism
   00310 Lysine degradation
    Bxe_A2811
Enzymes [BR:bxe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bxe_A2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1837830..1839113
Genome map
AA seq 427 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIEIETDKVVLEVPAPSAGVLAQV
IANDGDTVTADQVIAKIDTEGTASAAAVEAEVKPAPQAAPAPAAAPAPAAQAASATGANT
AASPAAGKLMAEKGLGAGDVAGTGRDGRITKGDVLTAGAPAAKAAAPAPAAAPKAAKPSL
PDVKAPASAEQWLKDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMAPVMDLRN
KYKDKFEKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRG
LVVPILRNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPII
NPPQSAILGVHATKERAVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKDALEDP
ARLLLDL
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggctattgttgaagtcaaggtcccccagctttccgagtcggtttcggaagccaccatg
ctgcagtggaagaagaagcccggcgaggctgttgctcaagacgaaattctcatcgaaatc
gagaccgacaaggtcgtgctcgaagtgccggcaccctcggccggcgtgctcgcgcaagtc
atcgcgaacgacggcgacaccgtcacggctgatcaggtgatcgccaagatcgacaccgaa
ggcacggcaagcgccgctgctgtcgaagccgaagtcaagcccgctccgcaagccgcaccg
gcacccgccgctgcaccggctccggcggctcaagccgcatccgcaacgggtgcgaacacc
gctgcttcgccggccgccggcaagctgatggccgagaagggtctgggcgcgggcgacgtc
gccggcacgggccgcgacggccgcatcaccaagggcgacgtgctgaccgcgggcgcaccg
gctgcgaaggctgccgccccggctccggccgccgcaccgaaggcagcgaagccgtcgctg
ccggacgtcaaggcgccggcctcggctgagcaatggctgaaggaccgtccggaacaacgc
gtgccgatgtcgcgtctgcgtgcgcgtatcgccgaacgtctgctcgagtcgcagcaaacc
aacgccattctcaccacgttcaacgaagtgaacatggcgccggtcatggacctgcgcaac
aagtacaaagacaagttcgaaaaggaacatggcgtgaagctcggcttcatgtcgttcttc
gtgaaggcggcggtccacgcgctgaagaagttcccgctggtgaacgcgtcgatcgacggt
aacgatatcgtctatcacggctacttcgacatcggtatcgctgtcggttcgccgcgcggt
ctggtggtgccgatcctgcgcaacgcggatcagctgagcctcgctgaaatcgagaagaag
attgctgaattcggccagaaggcgaaagacggcaagctgtcgatcgaagaaatgaccggc
ggcacgttctcgatctcgaacggtggcgtgttcggttcgatgctgtcgaccccgatcatc
aacccgccgcaatccgcgattctgggcgtgcacgccacgaaggaacgcgccgtggtcgaa
aacggccagatcgtgatccgcccgatgaactatctggcgctgtcgtacgaccaccgcatc
atcgacggtcgcgaagcggtgctgtcgctggtcgccatgaaggatgcgctggaagatccg
gctcgcctgctgctcgacctgtaa

DBGET integrated database retrieval system