KEGG   Burkholderia xenovorans: Bxe_A2837Help
Entry
Bxe_A2837         CDS       T00340                                 

Definition
exodeoxyribonuclease V, alpha subunit (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bxe  Burkholderia xenovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bxe_A2837
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bxe_A2837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1803918..1806032
Genome map
AA seq 704 aa AA seqDB search
MSTFEQSASAPPELDDIGVNLPAPADFSTALAEGFARRIGTLARRGGASAEAVKWAARGA
FAASRATAEGHVCVPLALLARRFEASGAEVRAALFASGMASDGSQSAAALRPLVVDGQGR
LYLARYYDYERRLARALVAHAGAGVGTRAAPGAEAGGNAQTLHERLLRYFGTPKDNEVDW
QRVAAVMALSGQLTIVSGGPGTGKTTTVVGVLACLLDARADLRIALGAPTGKAAQRMQEA
LLARAGDLPPELAARLPQTSYTLHRLLGSGPGGRFRHHRDNPLPYDVVVIDEASMIDVAM
AAHLLDALAPQTRLVMLGDKDQLAAVEAGAVFAELSARPAFTQEGVRRLAEALGIDETRL
TQALPHASRSLGEEQAGSFPQSNAPHGFEARPDDLFAYADSPEVFNEPLAGELSEGAASS
PGPAPHALNPLADCVVWLERNYRFGLESPIGRLSLAIRNGSSSAALDVLRIDPAESCAAA
LYEDTHATLAERTVARLAAGFAPYADALAAALAADTPDPLPLFDALNRFRILCATRSGPR
GVDQVNAAMAAQVRRSAGVTLAVGAQWFAGRPVMVTRNDYALGLFNGDIGIALPGASGAL
RVHFRTGDGGLRAVSPAALPPHDTAFALTVHKSQGSEFEHAVLMLPSAFSRVLSRELVYT
AITRARERVEVVGARAVLAQAIATPTQRDSGLAARIAEAWHGAE
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgttcgaacagagcgcatccgcgccgcccgagctcgacgatatcggcgtgaat
ttgccagcgccggccgatttcagcaccgcgctcgcggaaggtttcgcgcgtcgcatcggc
acgctggcgcggcgcggcggtgcatcggcggaggcggtcaagtgggcggcgcggggcgcg
ttcgccgcgagccgcgcaacggccgagggccatgtgtgcgtgccgctcgcgttgctggcg
cggcgcttcgaggcatcgggcgccgaagtgcgcgcggcgctgttcgcaagcggcatggcg
agcgacggctcgcaaagcgcggcagcgttgcggccgctggtggtggatgggcaagggcgg
ttgtatctggctcgctattacgactacgagcggcggcttgcgcgcgcgctggtcgcgcat
gctggagcgggggtcggtactcgcgccgctcccggtgctgaagcaggcggcaacgcgcag
actttgcacgagcgcctgctgcgctacttcggcacgccgaaagacaatgaagtggactgg
caacgtgtcgcggcggtcatggcgctgtcgggacaacttactatcgtcagcggcggaccc
ggtaccggcaagaccaccaccgtggtcggcgtgcttgcctgcctgctcgatgcgcgcgcg
gatctgcgaatcgcactgggggcgcccacgggcaaagcggcacaacgcatgcaggaggcc
ttgctcgcgcgtgccggcgatctgccgcccgaactcgccgcgcgtttgccgcagacgtcg
tacacgttgcatcgtctgctcggttccggaccgggcgggcgcttccggcatcatcgggac
aatccgctgccttacgatgtcgtggtgatcgacgaggcgtcgatgatcgacgtcgcgatg
gccgcgcatctgctcgacgcccttgcaccgcagacgcgtctcgtgatgctgggcgacaag
gaccagctggccgcggtcgaagccggcgcggtgttcgccgaactcagcgcgcgtccggcg
ttcacgcaagagggtgtgcggcggctcgcggaggcgctcggtatcgacgaaacacggctg
acgcaggcgttgccgcacgcgtcgcgcagcctgggcgaagagcaggccggttctttcccg
cagtccaatgcgccgcacggtttcgaagcgcggcccgacgatctgttcgcctatgccgac
tcgccggaggtttttaatgaaccgctcgcgggtgagctttctgaaggcgccgcgtcatcg
cccggtccggcaccgcacgcgctgaacccgctcgccgactgcgtcgtctggctcgaacgt
aactatcggttcggtctcgaatcgccgatcggccggctgtcactcgcgatccgcaacggc
tcgtcgagcgcggcgctcgacgtcctgcgcatcgatcccgcggaatcttgcgcagcggcg
ctttacgaagacacccatgcaacgcttgccgagcgcaccgtcgcgcgtcttgccgcaggc
ttcgcgccctacgccgacgcgctggccgcggcgctcgcagccgacacgcccgacccgttg
ccgcttttcgacgcgttgaaccgtttccgcattctgtgcgcgacccgttcggggccgcgc
ggcgtcgatcaggtgaatgcggcgatggcggcgcaggtgcggcgctcggccggtgtgacg
ctggcagtgggcgcgcagtggttcgccgggcgtcccgtgatggtgacgcgcaacgactat
gcactgggtctcttcaacggcgacatcggcattgcgctgccgggcgcgagcggcgcgttg
cgcgtgcatttccgtaccggcgacggcggcttgcgggcggtatcgccggcggcgcttccg
ccgcacgacaccgcatttgcgctcacggttcacaagtcgcagggctcggagttcgagcac
gcggtgctaatgctgccgtcggcgttcagccgggtgttgtcgcgcgagctggtgtacacg
gcgatcactcgcgcgcgcgagcgggtggaagtggtcggcgctcgcgccgtgctggcgcag
gccattgccacgccgacccagcgcgattcgggattggccgcgcgaatagcggaggcgtgg
cacggcgctgaatag

DBGET integrated database retrieval system