KEGG   Burkholderia xenovorans: Bxe_A3156Help
Entry
Bxe_A3156         CDS       T00340                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bxe  Burkholderia xenovorans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bxe00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:bxe00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1449947..1450744
Genome map
AA seq 265 aa AA seqDB search
MSSLNTNLNGKVAVVTGAASGIGKQIALTLSAAGAAVAIADLNQDGANAVAEEIRKGGGK
AIGVAMDVTNEDAVNQGIDKVAAELGSVDILISNAGIQIVNPIENYSFSDWKKMQAIHVD
GAFLTTKAALKHMYKDDRGGIVIYMGSVHSHEASPLKSAYVTAKHALLGLSRVLAKEGAK
HNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEDVVKRVMLGGTVDGVFTTVEDVAQTV
LFLSTFPTAALTGQSFIVSHGWYMQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactgaacacaaatctgaatggcaaagtcgcggtggttaccggcgccgcaagc
ggcatcggcaagcagattgcgctgaccctttccgcggcgggcgcagcggttgcgatcgcc
gacctgaaccaggacggggcgaatgccgttgctgaggaaatcagaaagggcggcggcaag
gcaatcggtgtggcgatggacgtcacgaatgaagacgccgtcaaccagggcatcgacaag
gtcgccgcggaactcggctcggttgacattcttatttccaacgccggcatccagatcgtc
aatccgatcgaaaactattcgttttcagactggaagaagatgcaggcgatccatgtggac
ggcgccttcctgaccaccaaggcagcgctcaagcacatgtacaaagacgatcgcggcggc
atcgtgatctacatgggttcggtccattcgcatgaagcgtcgccgctcaaatcggcttat
gtgacggcaaagcatgcgctgcttggcctctcgcgcgtgctcgccaaagaaggcgcaaag
cacaacgtgcgctcgcacgtggtgtgtccgggtttcgtacgtacgccgctcgtcgacaag
cagattcccgagcaggccaaggaactcggcatcagcgaggaagatgtggtgaagcgcgtc
atgctgggcggtacggtcgacggtgtcttcaccacggtggaagacgtcgcgcagacggtg
ctgttcctgtccaccttcccgacggcggcgctcaccgggcagtcctttattgtgagccac
ggctggtatatgcaataa

DBGET integrated database retrieval system