KEGG   Paraburkholderia xenovorans LB400: Bxe_A3156Help
Entry
Bxe_A3156         CDS       T00340                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00072  Synthesis and degradation of ketone bodies
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bxe_A3156
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bxe_A3156
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bxe_A3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase THF_DHG_CYH_C Phage_T4_gp36 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABE29823
JGI: BxeA3156
UniProt: Q142B6
Position
1:1449947..1450744
Genome map
AA seq 265 aa AA seqDB search
MSSLNTNLNGKVAVVTGAASGIGKQIALTLSAAGAAVAIADLNQDGANAVAEEIRKGGGK
AIGVAMDVTNEDAVNQGIDKVAAELGSVDILISNAGIQIVNPIENYSFSDWKKMQAIHVD
GAFLTTKAALKHMYKDDRGGIVIYMGSVHSHEASPLKSAYVTAKHALLGLSRVLAKEGAK
HNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEDVVKRVMLGGTVDGVFTTVEDVAQTV
LFLSTFPTAALTGQSFIVSHGWYMQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactgaacacaaatctgaatggcaaagtcgcggtggttaccggcgccgcaagc
ggcatcggcaagcagattgcgctgaccctttccgcggcgggcgcagcggttgcgatcgcc
gacctgaaccaggacggggcgaatgccgttgctgaggaaatcagaaagggcggcggcaag
gcaatcggtgtggcgatggacgtcacgaatgaagacgccgtcaaccagggcatcgacaag
gtcgccgcggaactcggctcggttgacattcttatttccaacgccggcatccagatcgtc
aatccgatcgaaaactattcgttttcagactggaagaagatgcaggcgatccatgtggac
ggcgccttcctgaccaccaaggcagcgctcaagcacatgtacaaagacgatcgcggcggc
atcgtgatctacatgggttcggtccattcgcatgaagcgtcgccgctcaaatcggcttat
gtgacggcaaagcatgcgctgcttggcctctcgcgcgtgctcgccaaagaaggcgcaaag
cacaacgtgcgctcgcacgtggtgtgtccgggtttcgtacgtacgccgctcgtcgacaag
cagattcccgagcaggccaaggaactcggcatcagcgaggaagatgtggtgaagcgcgtc
atgctgggcggtacggtcgacggtgtcttcaccacggtggaagacgtcgcgcagacggtg
ctgttcctgtccaccttcccgacggcggcgctcaccgggcagtcctttattgtgagccac
ggctggtatatgcaataa

DBGET integrated database retrieval system