KEGG   Burkholderia xenovorans: Bxe_A3156Help
Entry
Bxe_A3156         CDS       T00340                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bxe  Burkholderia xenovorans
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bxe_A3156
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bxe_A3156
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bxe_A3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1449947..1450744
Genome map
AA seq 265 aa AA seqDB search
MSSLNTNLNGKVAVVTGAASGIGKQIALTLSAAGAAVAIADLNQDGANAVAEEIRKGGGK
AIGVAMDVTNEDAVNQGIDKVAAELGSVDILISNAGIQIVNPIENYSFSDWKKMQAIHVD
GAFLTTKAALKHMYKDDRGGIVIYMGSVHSHEASPLKSAYVTAKHALLGLSRVLAKEGAK
HNVRSHVVCPGFVRTPLVDKQIPEQAKELGISEEDVVKRVMLGGTVDGVFTTVEDVAQTV
LFLSTFPTAALTGQSFIVSHGWYMQ
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactgaacacaaatctgaatggcaaagtcgcggtggttaccggcgccgcaagc
ggcatcggcaagcagattgcgctgaccctttccgcggcgggcgcagcggttgcgatcgcc
gacctgaaccaggacggggcgaatgccgttgctgaggaaatcagaaagggcggcggcaag
gcaatcggtgtggcgatggacgtcacgaatgaagacgccgtcaaccagggcatcgacaag
gtcgccgcggaactcggctcggttgacattcttatttccaacgccggcatccagatcgtc
aatccgatcgaaaactattcgttttcagactggaagaagatgcaggcgatccatgtggac
ggcgccttcctgaccaccaaggcagcgctcaagcacatgtacaaagacgatcgcggcggc
atcgtgatctacatgggttcggtccattcgcatgaagcgtcgccgctcaaatcggcttat
gtgacggcaaagcatgcgctgcttggcctctcgcgcgtgctcgccaaagaaggcgcaaag
cacaacgtgcgctcgcacgtggtgtgtccgggtttcgtacgtacgccgctcgtcgacaag
cagattcccgagcaggccaaggaactcggcatcagcgaggaagatgtggtgaagcgcgtc
atgctgggcggtacggtcgacggtgtcttcaccacggtggaagacgtcgcgcagacggtg
ctgttcctgtccaccttcccgacggcggcgctcaccgggcagtcctttattgtgagccac
ggctggtatatgcaataa

DBGET integrated database retrieval system