KEGG   Paraburkholderia xenovorans LB400: Bxe_A3216Help
Entry
Bxe_A3216         CDS       T00340                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A3216
   01230 Biosynthesis of amino acids
    Bxe_A3216
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A3216
   00051 Fructose and mannose metabolism
    Bxe_A3216
   00562 Inositol phosphate metabolism
    Bxe_A3216
Enzymes [BR:bxe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bxe_A3216
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bxe_A3216
  Exosomal proteins of bladder cancer cells
   Bxe_A3216
  Exosomal proteins of melanoma cells
   Bxe_A3216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:1380735..1381511
Genome map
AA seq 258 aa AA seqDB search
MSKQRAKLVVGNWKMHGRLAENAVLLQAVAQGAGELPAQVRVGVCVPSPYLAQSQSLLEG
SRVAWGVQDVSAFTHGAYTGEVAAPMAVDFGATLAIVGHSERRAYHRESAELVAVKTQRV
LEAGLTPIVCVGETLEEREAGSTEQVVGMQLDEVLAKLSEQEAARIVVAYEPVWAIGTGK
SASSEQAQAVHAFLRARLAAKGAAVADVPLLYGGSVKPENAEELFRQPDIDGGLIGGASL
KAQDFLVICKAATTSVAG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgagccaaactggtagtcggtaactggaagatgcacgggcgcctcgcc
gaaaatgccgtgctgttgcaggcggtggcgcaaggcgcgggcgaattgccggctcaagtg
cgcgtcggtgtttgcgtgccgagcccgtatctcgcgcagtctcaatcgttgctggaaggc
agccgggtggcgtggggcgtgcaggacgtgtcagcgttcacgcatggcgcctacaccggc
gaagtggccgcgccgatggcggtggatttcggtgccacgctggcgatcgtcgggcattcg
gagcgccgtgcctatcatcgcgagagcgccgagctggtcgcggtgaaaacgcagcgcgtg
ctggaagcgggtttgacgccgatcgtctgtgtcggcgaaacgcttgaagagcgcgaagcc
ggttcgaccgagcaggtggtcggcatgcaactggacgaagtgctggcgaaattgtcggag
caggaggcggcgcggattgtcgtcgcgtatgagccggtttgggctatcggcaccggcaag
agcgcgagctctgaacaggcgcaagcggttcacgcgttcctgcgcgcgcgtctggcggca
aagggcgcggcagtggcggatgtcccgctgttgtacggcggcagcgtgaaaccggaaaac
gcggaagaattgttccgccagccggatatcgacggtggcctgatcggcggcgcgtcgttg
aaagcccaggatttcctggtgatctgcaaggcggccacaacgagcgtcgccggttga

DBGET integrated database retrieval system