KEGG   Burkholderia xenovorans: Bxe_A3438Help
Entry
Bxe_A3438         CDS       T00340                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bxe  Burkholderia xenovorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bxe_A3438
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bxe_A3438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1132638..1133666
Genome map
AA seq 342 aa AA seqDB search
MIFRAAFFHCRDTMNTSSFIHPDAGERPQPLSGNAMPRCGGIATMMRLPNVGSAEGFDAC
FVGVPFDLGTSNRTGARFGPRQIRSESVLLRPYNMATRAAPFDSLRVADLGDVAINPYNL
HDSIARIETAYDEILQHDCKPITLGGDHTIALPILRAMHRKHGKVGLIHVDAHADVNDTM
MGEKIAHGTPFRRAVEEGLLDCGRVVQIGLRGTGYAAEDFDWCRDQGFEVVQAEACWNQS
LAPLMARVRERMGDGPVYITFDIDGIDPAFAPGTGTPEIAGLTVPQALEIIRGSRGLNIV
GCDLVEVAPPYDPFGTTALLGANLAFELLCVLPGVEYRASTR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgattttccgtgctgccttttttcattgccgagacacgatgaatacctcttccttcatt
caccctgacgctggcgaacggccgcagccgctgtccggcaacgccatgccccgctgcggc
ggcatcgcaacgatgatgcggctgccgaacgtcggctccgccgaagggttcgacgcctgc
ttcgtcggtgtgccgttcgatctcggcacttcgaaccgcacgggcgcgcgcttcgggccg
cgccagatccgcagcgagtccgtgctgctgcgtccgtacaacatggcgacgcgcgcggca
ccgttcgattcgctgcgcgtggccgatctcggcgacgtcgcgatcaacccgtacaacctg
cacgattcgatcgcgcgcatcgaaaccgcgtacgacgaaattctccagcacgattgcaag
ccgatcacgctgggcggcgatcacaccatcgcgctgccgatcctgcgcgcgatgcatcgc
aagcacggcaaggtcggcctgattcacgtggacgcgcacgccgacgtcaacgacacgatg
atgggcgagaagatcgcgcacggcacgccgttccgccgcgcggtggaggagggtttgctc
gattgcgggcgcgtcgtgcagatcggtttgcgcggcacgggttacgcggcggaggacttc
gactggtgccgcgatcagggtttcgaagtcgtgcaggccgaggcctgctggaaccagtcg
ctcgcgccgctgatggcgcgtgtgcgcgagcgcatgggcgacggccccgtgtacatcacg
ttcgacatcgacgggatcgatccggcttttgcgccgggaacgggcaccccggaaatcgcg
ggtttgacggtgccgcaggcgctggaaatcattcgcggctcgcgtgggctgaatatcgtc
ggctgcgatctggtcgaagtcgcgccaccatacgatccgttcggcacgaccgcgctgctc
ggcgcgaatctcgcgttcgaattgctgtgtgtgttgccgggcgtcgagtatcgggcgtcc
acccgctga

DBGET integrated database retrieval system