KEGG   Burkholderia xenovorans: Bxe_A3701Help
Entry
Bxe_A3701         CDS       T00340                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A3701
   00030 Pentose phosphate pathway
    Bxe_A3701
   00051 Fructose and mannose metabolism
    Bxe_A3701
   00052 Galactose metabolism
    Bxe_A3701
   00500 Starch and sucrose metabolism
    Bxe_A3701
   00520 Amino sugar and nucleotide sugar metabolism
    Bxe_A3701
  Nucleotide metabolism
   00230 Purine metabolism
    Bxe_A3701
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bxe_A3701
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bxe_A3701
    5.4.2.8  phosphomannomutase
     Bxe_A3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:846724..848118
Genome map
AA seq 464 aa AA seqDB search
MISKSIFKAYDIRGVIGKTLDADAARSIGRAFGSEVRAQGGDAVVVARDGRLSGPELIQA
LSDGLRAAGVDVVNVGMVPTPVGYFAASVPLKLEGGERRVDSCIVVTGSHNPPDYNGFKM
VLRGAAIYGEQILALHQRIVDENFSAGSGTYTEYDIAEAYLDRIASDIKLARPIKIVVDT
GNGVAGGLAPKLFKKLGCELVELFTEIDGNFPNHHPDPAHPENLQDVIRALKETDAEIGF
AFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNKGAQIIYDVKCTRNLAKWVKDKGG
EPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRWYGFDDGLYTGARLLEILTRVADP
SQLLNSLPNSNSTPELQLKLEEGENFELIARLQQNAKFTGADDVVKIDGLRVEYPDGFGL
ARSSNTTPVVVMRFEADNDAALKRIQEDFRRVILAEKADAKLPF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaagtctattttcaaggcatatgacattcgcggcgtaatcggcaagacgctc
gacgccgacgcagcgcgttcgatcggccgcgcgttcggcagcgaagtgcgggcgcaaggc
ggcgacgccgtggtggtcgcgcgcgacggccgcctgtcgggtcccgaactgatccaggcc
ctgtcggacggcctgcgcgcggccggtgtcgacgtggtcaacgtcggcatggtgcccact
ccggtcggctatttcgcggccagcgtgccattgaagctcgaaggcggcgagcgccgcgtc
gattcatgcatcgtcgtgacgggtagtcataatccgccggactacaacggcttcaagatg
gtcctgcgcggcgcggcgatttacggcgaacagattctcgcgctgcatcagcgcatcgtc
gacgagaacttttcggcaggcagcggcacgtacaccgagtacgacattgccgaggcctat
ctcgatcgcatcgcgagcgacatcaagctcgcgcgccccatcaagatcgtggtggacacc
ggcaacggcgtggccggcggcctcgcgccgaagctgttcaaaaagctcggctgcgaactg
gtcgaactgttcaccgagatcgacggcaacttcccgaaccatcacccggacccggcccac
ccggaaaacctgcaggacgtgatccgcgcgctgaaggaaacggacgctgaaatcggcttc
gctttcgacggcgacggcgaccgcctgggcgtagtcaccaaagacggccagatcatctac
ccggaccgccagctcatgctgttcgcggaagaagtgctgtcgcgcaacaagggcgcgcag
atcatttacgacgtgaagtgcacgcgcaacctcgcgaagtgggtgaaggacaagggcggc
gagccgctcatgtggaagaccggccactcgctcgtcaaggccaagctgcgcgaaaccggc
gcaccgctcgccggcgaaatgagcggccacgtgttcttcaaggaccgctggtacggtttc
gacgacggcctgtacacgggcgcgcgtctgctcgaaatcctcacgcgcgtggcggatccg
agccagctgctgaactcgctgccgaactcgaactccacgcccgaactgcaactgaagctc
gaagaaggcgaaaacttcgaactgatcgcgcgcctgcagcagaacgcaaagttcaccggc
gcggacgacgtcgtgaagatcgacggcctgcgtgtcgaatatccggacggcttcggtctt
gcgcgttcgtcgaacaccacgccggtcgtggtgatgcgtttcgaagccgataacgacgcg
gcgctcaagcgcattcaggaagacttccgccgcgtgatcctcgcggagaaggctgacgcg
aagctgccgttctga

DBGET integrated database retrieval system