KEGG   Paraburkholderia xenovorans LB400: Bxe_A3808Help
Entry
Bxe_A3808         CDS       T00340                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00240  Pyrimidine metabolism
bxe00250  Alanine, aspartate and glutamate metabolism
bxe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bxe_A3808
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bxe_A3808
Enzymes [BR:bxe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bxe_A3808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABE29190
JGI: BxeA3808
UniProt: Q144P9
Position
1:736152..737177
Genome map
AA seq 341 aa AA seqDB search
MNTATQAPKDSADSATERFRYGFLKGNPQLTKNGELKHLLSIEGLPKAIVNHILDTADQF
VSVTDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAATRLSADVLNLNINASSTSKGES
LLDTINNLSAMHADMFVVRHASSGAPYLIAQHCAPHVHVINAGDGRHAHPTQGLLDMYTI
RHYKKDFTKLRVAIVGDILHSRVARSDIHALTTLGVPEVRAIGPRTLLPGGLEQMGVRVF
HNLDEGLKDVDVIIMLRLQNERMSGALLPSAQEYFKSWGLTPERLALAAPEAIVMHPGPM
NRGVEIDSQVADGPQSVILNQVTFGIAVRMAVMGIVAGNHD
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgccacccaggctcccaaggattccgccgacagcgccaccgagcgcttccgt
tatggcttcctgaagggcaacccgcagctcacgaaaaacggcgagctgaaacatctgttg
tcgatcgagggtttgccgaaggcgatcgtcaatcacattctcgacaccgccgaccagttc
gtcagcgtgaccgatcgcgaagtgaagaaggtgccgctgctgcgcggcaagtcggtgttc
aatctgttcttcgagaactcgacgcgcacccgcaccactttcgagatcgccgcgacgcgt
ctttctgcggacgtgctcaatctgaacatcaacgcgtcgtcgaccagcaagggcgaatcg
ctgctcgacacgatcaacaacctctcggcgatgcacgccgatatgttcgtcgtgcgccac
gcatcgagcggcgcgccgtatctgatcgcccagcattgcgcgccgcacgtgcacgtgatc
aatgccggcgacggccgtcatgcgcaccctacgcaggggctgctcgacatgtacacgatc
cgccactacaagaaggatttcaccaagctgcgcgtggcgatcgtcggcgatattctgcat
tcgcgggtcgcgcgctcggacatccatgcgctgaccacgctcggcgtgccggaagtgcgc
gcgatcggtccgcgcacgctgctgccgggcggcctcgaacagatgggcgtgcgcgtgttc
cacaatctcgacgaaggcctgaaggacgtcgacgtgatcatcatgctgcgtctgcagaac
gaacggatgagcggcgcgttgctgccgtcggcgcaggagtacttcaagagctggggcttg
acgcccgagcgtctcgcgctcgccgcgccagaggcgatcgtgatgcacccgggcccgatg
aatcgcggcgtcgaaatcgattcgcaggtggccgacggaccgcagtcggtgattctgaat
caggtgaccttcggtatcgccgtgcgcatggcggtgatggggatcgtggccggcaatcac
gactga

DBGET integrated database retrieval system