KEGG   Burkholderia xenovorans LB400: Bxe_A3956Help
Entry
Bxe_A3956         CDS       T00340                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bxe_A3956
Enzymes [BR:bxe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Bxe_A3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(572294..572842)
Genome map
AA seq 182 aa AA seqDB search
MTVAYLGLGANLGDARQTLKDAVVCLAQQHTITVLAKSSLYRTAPIDAGGDDYFNCVVKV
DTTLPVRHLLALCHKIEHQFGRERPFRNAPRTLDLDILLFGDQSIDEADLIVPHPRLIER
AFALVPLVEIDSALIIPQHGRAEALLSKVSDQRIEKVKGPCQCPMLNALTVGEDKTGKGR
CE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcggcctcggcgcgaatctcggggacgcgcgccagaccctgaaa
gacgcggtggtgtgcctcgcacaacagcacaccatcaccgtgctcgccaagtcgagcctg
tatcgcactgccccgatcgacgcgggcggtgacgattatttcaactgcgtcgtgaaggtc
gatacgacgctccccgtgcggcatctgcttgcgctatgccacaagatcgaacatcagttc
ggccgcgaacggccgtttcgcaacgcgccgcgcacgctcgacctggacatcctgctattc
ggcgatcaatcgatcgacgaagccgatctgatcgtgccgcatcctcgcctgatcgaacgc
gcttttgcgctcgtgccgctcgtcgagatcgactccgccttgatcattccgcaacacggc
cgcgccgaggcgctgctcagcaaggtgagcgatcaacgcatcgagaaggtgaaaggacct
tgccagtgtcctatgctcaacgcgttgaccgtcggtgaagacaaaaccggcaagggccgc
tgcgaatga

DBGET integrated database retrieval system