KEGG   Burkholderia xenovorans: Bxe_A4181Help
Entry
Bxe_A4181         CDS       T00340                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A4181 (gpmA)
   01230 Biosynthesis of amino acids
    Bxe_A4181 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A4181 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bxe_A4181 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_A4181 (gpmA)
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bxe_A4181 (gpmA)
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bxe_A4181 (gpmA)
  Exosomal proteins of melanoma cells
   Bxe_A4181 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(317805..318551)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNNEAQQAGVLLKDSGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAARFGDEQVLVWRRSYDTP
PPALEPTDERAPYNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAIKSGRQVLIA
AHGNSIRALVKYLDDISDNDIVGLNIPNGVPLVYELDENLRPIKHYYLGDQEAIAKAQAA
VARQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
acgggctgggtcgacgtcgacctcaccgagcagggcaacaatgaggcgcagcaagcgggc
gtgctgctgaaggattcgggctacacgttcgacatcgcctacacgtcggtgctcaagcgc
gcgatccgcaccttgtggcacgtgcaggacaagatggatctgatgtacctgccggtggtc
cattcgtggcgtctgaacgaacggcactacggtgcgctgtcgggtctgaacaaggctgag
acggccgccagattcggcgacgaacaggtgctggtctggcgccgcagctacgacacgccg
ccgcccgctctcgagccgacggacgagcgcgcgccctacaacgatccgcgctacgccaaa
gtgccgcgcgaacagttgccgctcaccgaatgcctgaaggacacggtcgcgcgcgttctg
cccctgtggaacgagtcgattgcgccggccatcaagtcgggccgccaggtgctgatcgcc
gcccacggcaattcgatccgcgcgctcgtcaaatacctcgacgatatttcggacaacgac
atcgtcggtctgaatattccgaacggcgtgccgctcgtttacgaactcgacgaaaacctg
cggccaatcaagcactactatctgggcgaccaggaagcgatcgccaaggcgcaggccgca
gtcgccaggcagggaaaggcaggctga

DBGET integrated database retrieval system