KEGG   Paraburkholderia xenovorans LB400: Bxe_A4181Help
Entry
Bxe_A4181         CDS       T00340                                 

Definition
(GenBank) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bxe_A4181
   01230 Biosynthesis of amino acids
    Bxe_A4181
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_A4181
  Energy metabolism
   00680 Methane metabolism
    Bxe_A4181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_A4181
Enzymes [BR:bxe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bxe_A4181
Exosome [BR:bxe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bxe_A4181
  Exosomal proteins of melanoma cells
   Bxe_A4181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(317805..318551)
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNNEAQQAGVLLKDSGYTFDIAYTSVLKR
AIRTLWHVQDKMDLMYLPVVHSWRLNERHYGALSGLNKAETAARFGDEQVLVWRRSYDTP
PPALEPTDERAPYNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAIKSGRQVLIA
AHGNSIRALVKYLDDISDNDIVGLNIPNGVPLVYELDENLRPIKHYYLGDQEAIAKAQAA
VARQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
acgggctgggtcgacgtcgacctcaccgagcagggcaacaatgaggcgcagcaagcgggc
gtgctgctgaaggattcgggctacacgttcgacatcgcctacacgtcggtgctcaagcgc
gcgatccgcaccttgtggcacgtgcaggacaagatggatctgatgtacctgccggtggtc
cattcgtggcgtctgaacgaacggcactacggtgcgctgtcgggtctgaacaaggctgag
acggccgccagattcggcgacgaacaggtgctggtctggcgccgcagctacgacacgccg
ccgcccgctctcgagccgacggacgagcgcgcgccctacaacgatccgcgctacgccaaa
gtgccgcgcgaacagttgccgctcaccgaatgcctgaaggacacggtcgcgcgcgttctg
cccctgtggaacgagtcgattgcgccggccatcaagtcgggccgccaggtgctgatcgcc
gcccacggcaattcgatccgcgcgctcgtcaaatacctcgacgatatttcggacaacgac
atcgtcggtctgaatattccgaacggcgtgccgctcgtttacgaactcgacgaaaacctg
cggccaatcaagcactactatctgggcgaccaggaagcgatcgccaaggcgcaggccgca
gtcgccaggcagggaaaggcaggctga

DBGET integrated database retrieval system