KEGG   Burkholderia xenovorans LB400: Bxe_A4303Help
Entry
Bxe_A4303         CDS       T00340                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bxe_A4303
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bxe_A4303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(183753..184541)
Genome map
AA seq 262 aa AA seqDB search
MADTLTTSKSELVATAERQMQTALPELVWATREKLALTCRILFEQGHDSGLAGQITARTD
EPDTYYTQRFGLGFDEITASNLVHVNQDLKLVSGEGMPNPANRFHTWIYRARPDVNCIIH
THPLHVAALSMLETPLVVSHMDLCPLHDDCAFLEQWPGVPVGNEEGEIISAALGGKRAIL
LSHHGQLVTGSTIEEACTLALLIERAAQMQLLAMAAGDVKPIPAELGREAHDWISTPKRN
QATFAYFARRALRSPMHRDCLA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagacactctcactacttcaaaaagcgaactagtggcaaccgcagagcggcagatg
cagaccgccttgcccgaactcgtatgggcgactcgcgagaagctcgcactgacctgccgg
attctgttcgagcagggccacgattccgggctcgccgggcagatcaccgcccgcaccgac
gagccggacacttactacacacagcgtttcggcctgggcttcgacgagatcacggcgtcg
aacctcgtccacgtgaatcaggatttgaagctcgtctccggcgagggcatgccgaatccg
gcgaaccgctttcacacgtggatctatcgggcgcgaccggatgtgaactgcatcatccac
acgcacccgctgcatgtcgccgcgctgtcgatgctggaaacgccgctcgtcgtctcgcac
atggatctgtgcccgctccatgacgattgcgcgtttctcgaacaatggccaggcgttccg
gtcggcaacgaagaaggcgaaatcatctcggcggcgctcggcgggaagcgcgcgatcctg
ctttcgcatcatggccaactggtcaccggcagcacgatcgaagaggcctgcacgctcgcg
ctcctgattgagcgcgccgcgcaaatgcaattgctcgcaatggcggccggcgacgtgaag
cccattcccgccgaactcggccgggaagcacacgactggatttccacacccaaacgcaat
caggcgacgttcgcctacttcgcccgccgcgcgctgcgcagtccgatgcaccgcgattgt
ctcgcctga

DBGET integrated database retrieval system