KEGG   Burkholderia xenovorans: Bxe_A4494Help
Entry
Bxe_A4494         CDS       T00340                                 

Definition
general secretory pathway protein J
Orthology
K02459  
general secretion pathway protein J
Organism
bxe  Burkholderia xenovorans
Pathway
Bacterial secretion system
Module
Type II general secretion system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Bxe_A4494
Secretion system [BR:bxe02044]
 Type II secretion system
  General secretion pathway protein [MD:M00331]
   Bxe_A4494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:4860586..4861191
Genome map
AA seq 201 aa AA seqDB search
MAIAILAVIAVLSWRGLDQIIRGRQTITNAMEDERVFAQLFDQMRIDARQAASDDESGQA
AVSVSASVLQIVRQINLPGAAPRLQVVRYRVSGGRVIRYASPPLGNMGELRRALRGGEGE
GWSSVPLMGGVGAISAQVYVPKVGWTTQMSDVQSAITEADNNLKVPQLGSAPLPRSVTGL
QVSVGATSLARPVTRVFLVGE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtggcgattgcgattctggcggtgattgccgtgctgtcgtggcgcggactcgaccagatc
attcgcggccggcagaccatcacgaacgcgatggaagacgagcgcgtgttcgcgcagctg
ttcgaccagatgcggatcgacgcgcgccaggccgcatcggacgacgagtccgggcaggcg
gccgtgtcggtatccgccagcgtgttgcagatcgtgcggcagatcaacttgccgggtgcg
gcgccgcgtttgcaggtggtgcggtatcgggtatccggtgggcgggtgattcggtatgct
tcgccgccgttggggaatatgggcgagttgcggcgggcgctgcgcggtggtgaaggagaa
ggatggagtagcgtgcccctgatgggtggggtcggggcgatttcggcgcaggtgtatgtg
ccgaaggtgggttggactacgcagatgagcgatgtgcagagtgcgattacggaggcggac
aataatctcaaagtaccccagttggggagtgcgccgctgccgcgttcggtgacggggttg
caggtgagtgttggggcgacttctttggctcggcctgttacgcgggtttttctcgtcgga
gagtga

DBGET integrated database retrieval system