KEGG   Burkholderia xenovorans: Bxe_B0346Help
Entry
Bxe_B0346         CDS       T00340                                 

Definition
putative cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bxe  Burkholderia xenovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2988719..2990194)
Genome map
AA seq 491 aa AA seqDB search
MRKISLGVICALSLILTACGGDGGSDSSSAGTDPSQPASGGVAPPAKVTLSAAAQVGQQL
FFDQNLSGNKNMSCATCHSPQYAYGPPNSLSVQLGSDPSVAGQRAVPSLRYKSMTPPYND
VADNPDGITQNAPGGGFMLDGRATTLATQPALPLLNPLEMNNASAGAVVQTVKSASYAAL
FQQAFGANVFSDANATFTDVGLALQAYQQEDPSFQPYASKFDLYLSNKVGGTLTPAELRG
LQLFNDTDGGAGCVACHYAGANFNGSVALMTDFTYQAIGAPRNDRQIWDNPDPIPSNDDT
SYYDMGLCGPLNNLHTPGTASSGAGPDQFTGVNVPDPYCGRFKVPTLRNVATRTVFFHNG
VFHSLVQVLNFYNTRDTNPEYWYPSTGGDPAHVTQNPSYALFPTAASGATATLFNDLPVA
YQGNIDEELPMGKGQTDAGGTTAADGALPRPVHSTPQLTQQNIADLICFLNTLTDGYQPP
ATPPTSGSCVN
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaaatctccctgggcgtgatctgcgcgctctcattgatattgaccgcctgcggc
ggcgacggtggcagcgacagcagcagcgccggcaccgacccgagccagcccgcatcgggc
ggcgtggcgccgccggccaaggtgaccctcagcgcggcggcgcaagtcggccagcaactg
ttcttcgaccagaatctgtcgggcaacaagaacatgtcctgcgcgacctgccacagccct
caatacgcgtatggaccgcccaacagcctgtccgtgcagctcggctccgatccctcggtg
gccgggcagcgcgccgtgccttcgctgcgctacaagtccatgacgccgccgtacaacgat
gtcgccgacaacccggacggcatcacgcagaatgcgcccggcggcggcttcatgctggac
ggacgtgccacgacgcttgccacccagccggccctgccgctgctcaatccgctcgaaatg
aacaatgcgtcggcgggcgccgtggtgcagaccgtgaagagcgcgtcctacgcggcgctg
ttccagcaggcattcggtgcgaacgtgttctccgacgcgaacgccaccttcaccgacgtc
ggtctcgccctgcaggcctatcagcaggaagacccgagcttccagccgtacgcgagcaag
ttcgacctgtatctgtccaacaaggtgggcggcacgctgacaccggcggaactgcgcggc
ctgcagctcttcaacgacaccgacggcggcgcgggatgcgttgcgtgccactatgccggc
gccaacttcaacggctcggtcgcgctcatgaccgacttcacctatcaggcgatcggcgcg
ccgcgcaacgacaggcagatctgggacaaccccgacccgatcccgagcaacgacgacacg
tcgtattacgacatgggtctttgcggtccgctgaacaacctccacacgccaggcacggcc
agcagcggtgccggcccggatcagttcaccggcgtcaatgtccccgacccgtactgcggc
cgcttcaaggtgccgacgctgcgcaatgtcgcgacgcgcacggtgttcttccacaacggc
gtattccactcgctcgtgcaggtgctgaatttctacaacacgcgcgatacgaatccggag
tactggtatccgagcaccggcggcgatcctgcccacgtaacgcaaaacccgtcctatgcg
ctgttcccgacagctgcgtcgggtgcgacggccacgctcttcaacgatctgcccgtggcc
taccagggcaatatcgacgaagaactgccaatgggcaaaggccagactgacgccggcggc
acgactgcggcagacggtgcgctgccgcgtccggttcactcgacaccgcagttgacgcag
cagaacattgcagacctgatctgcttcctgaacacgctcaccgacggctatcaaccgcct
gcgacgccgcccaccagcggctcgtgcgtgaactga

DBGET integrated database retrieval system