KEGG   Paraburkholderia xenovorans LB400: Bxe_B0946Help
Entry
Bxe_B0946         CDS       T00340                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00330  Arginine and proline metabolism
bxe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bxe_B0946
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bxe_B0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ABE35008
JGI: BxeB0946
UniProt: Q13LN1
Position
2:complement(2315378..2316346)
Genome map
AA seq 322 aa AA seqDB search
MTELVYGDGAIRRASLYGSSIENTYAGVLSFMRRKYTRELDGVDVVVSGVPLDLATTFRS
GARLGPAAVRAASVQLSELHPYPWGFNPFDDLAVTDYGDCWFDAHNPLTIKASIVEHART
ILRSGAKMLTLGGDHYMTYPLLIAHAEKYGRPVSLIHFDAHCDTWADDSPDSLNHGSMFY
KAVKDGLIDPETSVQIGIRTWNDDFMGINILDAAWVHEHGTRATVERIASIVGERPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQGLAIVRALGALNLVGADVVEVAPAYDQSEITAIA
AAHIACDLLCLWRQRKVAQRGA
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgactgaactcgtctatggcgacggcgcgatccgccgcgcgtcactctatggctcgtcg
atcgaaaacacctacgcgggcgtgctgtcgttcatgcgccgcaagtacacgcgtgaactc
gacggcgtcgacgtcgtggtctcgggcgtgccgctcgatctggccaccacgtttcgctcc
ggagcgcgcctcggacccgcggcggtgcgtgcggccagcgtgcagctgtcggaactgcat
ccgtatccgtggggtttcaatccgttcgacgacctcgccgtgaccgattatggcgactgc
tggttcgacgcgcacaatccgctcacgatcaaggcgtccatcgtcgagcatgcgcgcacg
attctgcgctcgggcgcaaagatgctgacactcggcggcgatcactacatgacctatccg
ctgttgatcgcgcatgcggagaagtacggcagaccggtctcgctgattcatttcgacgcc
cattgcgatacctgggccgacgacagtcccgacagcctgaatcacggttcgatgttctac
aaggcggtgaaggacggcctgatcgatccggagacctcggtgcagatcggcattcgcacg
tggaatgacgatttcatgggcatcaatattctcgacgccgcctgggtgcacgagcatggc
acgcgagcgacggtggagcggattgcgtcgatcgtgggggaacgtcccgcctatttgacg
ttcgatatcgactgtctcgatccggcgttcgcgccgggcacgggcacgccggtggcgggt
ggcttgtcgtcggcgcagggactggcgatcgtgcgcgcgctcggtgccttgaatctggtg
ggcgcggacgtcgtggaagtcgcacccgcttatgaccagagcgagatcacggcgattgcc
gctgcgcatatcgcgtgcgatctgttgtgcctgtggcgtcaacgcaaggttgcgcaacgc
ggcgcttaa

DBGET integrated database retrieval system