KEGG   Paraburkholderia xenovorans LB400: Bxe_B1116Help
Entry
Bxe_B1116         CDS       T00340                                 

Definition
(GenBank) Hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00860  Porphyrin and chlorophyll metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bxe_B1116
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bxe_B1116
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Bxe_B1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO Pyr_redox_2 FAD_oxidored Thi4 Pyr_redox FAD_binding_3 HI0933_like GIDA Lycopene_cycl AlaDh_PNT_C Trp_halogenase Pyr_redox_3 MCRA ApbA NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ABE34839
JGI: BxeB1116
UniProt: Q13M50
Position
2:complement(2140479..2141957)
Genome map
AA seq 492 aa AA seqDB search
MEISVSDRGASGASAPLRNRGAWQSARNDTTDSSRRKESVIVVGSGIAGLTAAYRLHQAG
IQVTVLEASDVVGGRMGDRRVGDIAFNSGARLVYPFGGAFNRLIADLSLHDALIPLRHLT
AQCVSPGGSHTIELMPSFRSLATPGLPMRERFALVGHALRMRAQRSRVDPDWAMSAIADD
PAADQQTLAEYVRDAIGPQALSSMVEPVFRSTRSFNPETLSALFYRSTVPHLIGEDTVFT
LKGGMGCVCEALAAQLDVRTNALVASIEATQGAEADERLDATRGQRFAVTLRDGAVLTAD
HVVCATEGSLAGTLVRNPQREEREMLQAVRYNALGVVHYGFSRPLPPTLQFASRGASSRI
STFQQLPAAPASGRPLTQIYCQLTPEAAQEAERRGLTDNLDALLRDELRARIPDFDRHVS
AVVNQWIPRKLPVFAPGYGERLQAFWRWQEGAVRDADRPVVYCGDWTSQALLTGACASGE
RAARIVLSRIRN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctgtatcggaccgcggtgcgtctggcgcttcggcgccgttgcgcaatcga
ggcgcatggcaaagcgcgcggaacgacacaacggactcatcccgcagaaaagaaagcgtg
atcgtcgttggctccggcattgccggtttgacggcggcctaccgcctgcatcaggccggc
atacaggtgaccgtgctcgaagcgagtgacgtggtgggcggacgcatgggcgaccggcgc
gtgggcgatattgcgttcaatagcggcgcgcgtctcgtgtatccgttcggcggcgcattt
aaccggctgatcgcggacctttcgcttcacgacgcgctgattccgctgcgtcatctgacg
gctcagtgcgtttcgcctggcggcagccacaccatcgaactcatgccttcgttccgctcg
ttggccacgcccggtctgccgatgcgcgagcgcttcgcgctggtgggccatgcgctcaga
atgcgagcgcagcgcagccgtgtcgatccggattgggcgatgagtgccatcgccgacgac
cctgccgccgatcagcaaactctcgcggaatacgtgcgcgatgcaatcggaccgcaggcg
ctctcgagcatggtcgaaccggtgttccgctcgacccgcagcttcaatcccgaaaccctg
tccgccctgttctaccggtcaaccgtgccgcatctgatcggcgaagataccgtattcacg
ttgaagggcggcatgggctgcgtgtgtgaggcgctggccgcgcagctcgatgtgcgtacg
aatgcgctcgtggcatcgatcgaggccacgcagggtgccgaggctgatgagcgcctcgac
gcgacgcgcggccagcgatttgcggtgacgctgcgcgacggcgcggtgctgacggcggac
cacgtcgtgtgtgcgacggaaggctcgctcgctggcacgctcgtccgcaatccgcagcgc
gaggagcgtgagatgctccaggcggtgcgctacaacgcgctcggtgtcgtccactatggt
ttttcgcggccgctcccgccgacgttgcagtttgcgtcgcgtggcgcgtccagccggatt
tcgacgttccagcagttgcccgccgcgcccgccagcgggcgaccgcttacgcagatctac
tgtcaactgacgcccgaagccgcgcaggaggccgaacggcgcgggctgaccgacaacctc
gatgcgctgctgcgcgacgaactgcgcgcgcggattcccgatttcgaccgccatgtgagc
gcggtcgtgaatcagtggattccccgcaagctgccggtgttcgcgccgggctatggcgag
cggctacaggcgttctggcgctggcaggagggcgccgtgcgcgacgcggaccgcccggtc
gtctactgcggcgactggacttctcaggcgctgctgacgggcgcttgcgcgagcggcgag
cgcgcggcccggatcgtactgtcgcgcatccggaattag

DBGET integrated database retrieval system