KEGG   Burkholderia xenovorans: Bxe_B1116Help
Entry
Bxe_B1116         CDS       T00340                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bxe  Burkholderia xenovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bxe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2140479..2141957)
Genome map
AA seq 492 aa AA seqDB search
MEISVSDRGASGASAPLRNRGAWQSARNDTTDSSRRKESVIVVGSGIAGLTAAYRLHQAG
IQVTVLEASDVVGGRMGDRRVGDIAFNSGARLVYPFGGAFNRLIADLSLHDALIPLRHLT
AQCVSPGGSHTIELMPSFRSLATPGLPMRERFALVGHALRMRAQRSRVDPDWAMSAIADD
PAADQQTLAEYVRDAIGPQALSSMVEPVFRSTRSFNPETLSALFYRSTVPHLIGEDTVFT
LKGGMGCVCEALAAQLDVRTNALVASIEATQGAEADERLDATRGQRFAVTLRDGAVLTAD
HVVCATEGSLAGTLVRNPQREEREMLQAVRYNALGVVHYGFSRPLPPTLQFASRGASSRI
STFQQLPAAPASGRPLTQIYCQLTPEAAQEAERRGLTDNLDALLRDELRARIPDFDRHVS
AVVNQWIPRKLPVFAPGYGERLQAFWRWQEGAVRDADRPVVYCGDWTSQALLTGACASGE
RAARIVLSRIRN
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaaatatctgtatcggaccgcggtgcgtctggcgcttcggcgccgttgcgcaatcga
ggcgcatggcaaagcgcgcggaacgacacaacggactcatcccgcagaaaagaaagcgtg
atcgtcgttggctccggcattgccggtttgacggcggcctaccgcctgcatcaggccggc
atacaggtgaccgtgctcgaagcgagtgacgtggtgggcggacgcatgggcgaccggcgc
gtgggcgatattgcgttcaatagcggcgcgcgtctcgtgtatccgttcggcggcgcattt
aaccggctgatcgcggacctttcgcttcacgacgcgctgattccgctgcgtcatctgacg
gctcagtgcgtttcgcctggcggcagccacaccatcgaactcatgccttcgttccgctcg
ttggccacgcccggtctgccgatgcgcgagcgcttcgcgctggtgggccatgcgctcaga
atgcgagcgcagcgcagccgtgtcgatccggattgggcgatgagtgccatcgccgacgac
cctgccgccgatcagcaaactctcgcggaatacgtgcgcgatgcaatcggaccgcaggcg
ctctcgagcatggtcgaaccggtgttccgctcgacccgcagcttcaatcccgaaaccctg
tccgccctgttctaccggtcaaccgtgccgcatctgatcggcgaagataccgtattcacg
ttgaagggcggcatgggctgcgtgtgtgaggcgctggccgcgcagctcgatgtgcgtacg
aatgcgctcgtggcatcgatcgaggccacgcagggtgccgaggctgatgagcgcctcgac
gcgacgcgcggccagcgatttgcggtgacgctgcgcgacggcgcggtgctgacggcggac
cacgtcgtgtgtgcgacggaaggctcgctcgctggcacgctcgtccgcaatccgcagcgc
gaggagcgtgagatgctccaggcggtgcgctacaacgcgctcggtgtcgtccactatggt
ttttcgcggccgctcccgccgacgttgcagtttgcgtcgcgtggcgcgtccagccggatt
tcgacgttccagcagttgcccgccgcgcccgccagcgggcgaccgcttacgcagatctac
tgtcaactgacgcccgaagccgcgcaggaggccgaacggcgcgggctgaccgacaacctc
gatgcgctgctgcgcgacgaactgcgcgcgcggattcccgatttcgaccgccatgtgagc
gcggtcgtgaatcagtggattccccgcaagctgccggtgttcgcgccgggctatggcgag
cggctacaggcgttctggcgctggcaggagggcgccgtgcgcgacgcggaccgcccggtc
gtctactgcggcgactggacttctcaggcgctgctgacgggcgcttgcgcgagcggcgag
cgcgcggcccggatcgtactgtcgcgcatccggaattag

DBGET integrated database retrieval system