KEGG   Burkholderia xenovorans: Bxe_B1127Help
Entry
Bxe_B1127         CDS       T00340                                 

Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
bxe  Burkholderia xenovorans
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bxe00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bxe00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:bxe00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2128239..2129153
Genome map
AA seq 304 aa AA seqDB search
MNYASILEQIHGDLQPYLGSGKVADYIPELARVPADSFGMAIVTASGEVFRTGEADTRFS
IQSISKLFACTMAFRLLGDALWQRVGREPSGNAFNSLVQLEAEQGKPRNPFINAGALVVT
DVLCRRFVQAETALVEFMRRLTGEAGIDYDSRVAQSELQHAHRNRAMAHFMASFGNMEMP
PEVVVDAYCRQCAISMSCVELAKAALFLTNHGVVPATGERILDTSSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWSPGLDSNGNSLAGVLALEWLTTCTG
QSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgcatccatcctcgaacagatccacggtgatctgcagccttatctgggctcc
ggcaaggtcgccgattacattcccgagctcgccagagtgcccgccgacagtttcggcatg
gcgatcgtcacggcatcgggcgaagtgttccgcaccggcgaggccgacacgcgcttctcc
attcagagcatttccaagctgttcgcctgcacgatggcgttccgcctgctcggcgacgcg
ttgtggcagcgcgtggggcgcgagccgtccggcaatgccttcaactcgctggttcagctc
gaagcggaacagggcaagccgcgcaatccgttcatcaacgcgggcgcgctggtggtcacc
gacgtgctgtgccgccgtttcgtgcaggcggagacggcgctggtcgaattcatgcgacgg
ctcacgggcgaagcgggcatcgactacgactcgcgcgtcgcgcaatcggaattgcagcac
gcccaccgcaaccgcgcgatggcgcatttcatggcgagcttcggcaacatggagatgccg
ccggaagtggtggtcgacgcttattgccgtcaatgcgcgatctcgatgagttgcgtcgag
ttggcgaaagcggcgctgttcctgaccaatcacggcgtggtgccggccaccggagaacgg
attctggacacgagttcggccaagcgtctttccgcgttgatgctgacctgcggcacgtat
gacgccgcgggcgatttcgtctaccgcgtcggcttgccggcgaagagcggcgtgggcggc
gggatcgttgccgtgctgcccggcgagatggcggtatgcgtgtggtcgccggggctggac
agcaatggtaattcgctggcgggtgtgctggcgttggagtggttgaccacctgcacgggg
cagtccattttttga

DBGET integrated database retrieval system