KEGG   Burkholderia xenovorans: Bxe_B1345Help
Entry
Bxe_B1345         CDS       T00340                                 

Definition
putative phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
bxe  Burkholderia xenovorans
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bxe_B1345
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bxe_B1345
Enzymes [BR:bxe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Bxe_B1345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1882080..1884473)
Genome map
AA seq 797 aa AA seqDB search
MAEASSRPTPPQVLDADTLRNMDRYWRACNYLSAGMIYLRDNPLLREPLKPEHIKNRLLG
HWGSDPGQSFLLVHLNRLIRKLDLNVIYVAGPGHGAPATLAHCYLEGHYSEIYPDRSEDE
AGMQRFFRQFSFPGGIGSHCTPETPGSIHEGGELGYSLSHGYGAAFDNPDLIVTVMIGDG
EAETGPLATSWHSNKFLNPVRDGAVLPVLHLNGYKIANPTILARIPREELEALLTGYGHK
PYFVEGDDPAVMHQQMAATLEQCIGEIRAIQQHARANNDATRPRWPMIVLRSPKGWTGPK
EVDGHKVEGSWRAHQVPVLDPVTNGKSLKLVENWMRSYEPESLFDEAGRLVEELRELAPK
GARRISANPHANGGLLCKTLDMPAFGDYAVAVKKPGGTYTSPTEVLGKFLCDVMRRNMTN
FRVFGPDETASNKLTAIYEASEKTWLAQTEPSDADGGDLAVDGRVMEMLSEHTLEGWFEG
YVLTGRHGLFATYEAFVHVIDSMFNQHAKWLEKAKRDLGWRQPVPSINLLITSLVWRQDH
NGFTHQDPGFLDVVTNKSPDVVRIYLPPDANCLLSVADHCLRSRDYVNVIVADKQPHLQY
LDMDAAVIHCTKGIGIWDWASTDQGVEPDVVIASAGDIATMEALAAVQILKERFADLKIR
FVNVVDLFRLMPEHAHPHGLSNRDFDSLFTATKPVIFNFHSYASLVHKLTYNRTNHDNLH
VHGYHEKGNINTPLELAIINQVDRFSLAIDVIDRVPKLRGVGDHAKEWLRGQVIEHLAYA
HAEGIDREEIRNWTWKG
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaagctcccgtcccacaccgccgcaagtcctggatgccgacacgttgcgc
aacatggatcgctactggcgcgcctgcaactacctctcggccgggatgatctatctgcgc
gacaatccgctgctgcgcgagccgctgaaacccgagcacatcaagaaccgtctgctgggc
cattggggctcggacccggggcagagtttcctgctcgtgcatctgaaccggctgatcagg
aagctcgatctgaacgtcatctacgtggccggtccgggtcatggcgcgcctgccacgctc
gcgcattgctatctggaaggacattactcggaaatctatcccgaccgcagcgaagacgaa
gccggcatgcagcgcttcttccggcagttctcgtttccgggcggcatcggttcgcattgc
acgcccgagacgccgggctcgattcatgaaggcggcgaactcggctatagcctctcgcat
ggttacggcgccgcgttcgacaacccggacctgatcgtcaccgtgatgatcggcgacggc
gaagcggaaaccgggccgctcgccacctcgtggcactcgaacaaattcctcaatccggtt
cgcgatggcgcggtgttgccggtgctgcacctgaacggctacaagatcgccaatccgacc
attctcgcgcgcattccccgcgaggagctcgaagcgttgctgacgggttacggccacaag
ccgtatttcgtcgagggcgacgaccccgccgtcatgcatcaacagatggcggcgacgctc
gaacaatgcatcggcgaaatccgcgcgatccagcagcatgcgcgcgcaaacaacgacgcg
acgcgcccacgctggccgatgatcgtgctgcgttcgccgaaaggctggaccggcccgaag
gaagtcgacggccacaaggtggagggctcatggcgcgcgcaccaggtgccggtgctcgac
ccggtgaccaatggcaagagcctgaagctggtggaaaactggatgcgcagttacgagccc
gagtcgctgttcgacgaagccgggcgtctcgtcgaagaactgcgcgagctcgcgccgaag
ggagcgcgccgcatcagcgccaatccgcatgcgaacggcggcttgctgtgcaagacgctc
gacatgccggcgtttggcgactatgcggtggcggtgaagaaaccgggcggcacgtacacg
tcgccgaccgaggtgctcggcaaatttctatgcgacgtgatgcgcaggaacatgacgaac
ttccgcgtgttcggtcctgacgaaaccgcgagcaacaagctcaccgcgatctatgaagcg
tcggaaaaaacctggctcgcgcaaaccgagccgagcgacgcggacggcggcgatctcgcg
gtggacggccgcgtgatggaaatgctgagcgaacatacgctcgaaggctggttcgaaggc
tacgtgctgaccggccgccacggcctgttcgccacgtacgaagcgttcgtccacgtgatc
gattccatgttcaaccagcacgccaagtggctggagaaagccaaacgcgatctcggctgg
cggcagccggtgccgtcgatcaatctgctgattacctcgctcgtgtggcgccaggatcac
aacggtttcacgcaccaggaccccggctttctcgacgtggtcacgaataaaagcccggac
gtggtgcgcatttatctgccgcccgatgcgaactgcctgctgagtgttgccgatcattgt
ttgcgctcgcgcgactacgtcaacgtgatcgttgccgacaagcagccgcatctgcagtat
ctcgacatggacgcggcggtcatccattgcaccaagggcatcggcatctgggactgggcg
tccacggatcagggcgtcgaaccggacgtggtgatcgccagcgcgggcgacatcgccaca
atggaggcgctcgccgccgtgcagattctgaaggagcggttcgccgacctgaagatccgc
tttgtcaacgtggtcgacctgttccggctgatgcccgagcatgcgcatccgcacgggctg
tccaaccgcgatttcgattcgttgtttaccgcgaccaagccggtgatcttcaatttccac
tcgtatgcgtcgctggttcacaagctcacctataaccgcaccaaccacgacaacctgcac
gtgcacggctatcacgagaagggcaatatcaacacgccgctcgaactggccatcatcaat
caggtcgaccgcttctcgctggcgatcgacgtgattgatcgcgtgccgaaactgcgcggt
gtcggcgaccatgcgaaggaatggctgcgcggccaggttatcgagcacctggcttatgcg
cacgccgagggcatcgaccgggaagaaattcgcaactggacgtggaaaggctga

DBGET integrated database retrieval system