KEGG   Burkholderia xenovorans: Bxe_B1589Help
Entry
Bxe_B1589         CDS       T00340                                 

Gene name
fdsA
Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bxe  Burkholderia xenovorans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bxe01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bxe00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bxe00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1615402..1616601
Genome map
AA seq 399 aa AA seqDB search
MSSNRGVVYLGQGKVEVQSIDYPKMVDPRGRSIGHGVILKVVSTNICGSDQHMVRGRTTA
EVGLVLGHEITGEVIEIGRDVETLKIGDLVSVPFNVACGRCPTCKAQHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVMVPYADFNLLKFPDRAQALSKIRDLTCLSDILPTGYHGAV
MAGVKPGATVYIAGAGPVGMAAAASARLLGAACTIVGDMNEERLAHARKMGFQTVDLSKD
ATLGEQIEQILGKPEVDCAVDCVGFEAHGHGSSGSHEEAPAIVLNSLMEITRAAGAIGIP
GLYVTDDPGAADAAARKGSLSIRFGLGWAKSHSFHTGQTPVMKYNQNLMQAILWDRLPIA
DIVNVTVVSLDQAPDGYRQFDGGAPKKFVIDPHGLLKAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgcggcgtcgtgtatctggggcagggcaaggtggaagtgcagtcgatc
gactatccgaagatggtcgatccgcgtggccgttcgatcggtcacggcgtgatcctgaag
gtggtaagcaccaatatttgcggctccgatcagcacatggtgcgtggccgcacgaccgcc
gaggtcggcctcgtgctcggtcatgaaattaccggcgaggtgatcgagataggtcgcgac
gtggaaacgctgaagatcggcgatctcgtctcggtgccgttcaacgtggcctgcgggcgc
tgcccgacctgcaaggcgcagcataccggcgtgtgcctgaacgtgaatccgtcgcgtgcc
ggcggcgcttatggctacgtggacatgggcggctggatcggcggtcaggccgagtacgtg
atggtgccgtacgccgacttcaatctgctgaagttccccgaccgcgcgcaggcactgtcg
aaaatccgcgatctcacgtgcctgtcggacattctgccgaccggctatcacggcgcggtc
atggccggcgtgaagccgggcgcgaccgtgtatatcgcgggcgccgggccggtgggcatg
gccgccgccgcgtcggcgcgcctgctgggcgcggcttgcacgatcgtcggcgatatgaac
gaggagcgtctcgcgcacgcccgcaagatgggcttccagaccgtggacctgtcgaaggat
gctacgctcggcgagcagatcgaacagattctcggcaagccggaagtggattgcgcggtg
gactgcgtcggcttcgaagcgcacggccacggcagcagcggttcgcacgaggaagcgccg
gccattgtcctcaattcgctgatggaaatcacgcgcgccgcgggcgcgatcggcattccg
ggcctttacgtgacggacgaccccggcgccgccgatgccgccgcgcgcaaaggtagcctg
agcatccgttttggtctcggctgggcgaagtcgcactcgttccataccggacagacgccg
gtgatgaaatacaaccagaacctgatgcaggcgatcttgtgggaccgcttgccgattgcg
gatatcgtcaacgtgacggtggtgtcgctcgatcaggcgcctgatggttatcgccagttc
gatggcggtgcgccgaagaaattcgtgatcgacccgcacggattgctgaaggcggcataa

DBGET integrated database retrieval system