KEGG   Burkholderia xenovorans: Bxe_B1645Help
Entry
Bxe_B1645         CDS       T00340                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bxe  Burkholderia xenovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bxe_B1645
Enzymes [BR:bxe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Bxe_B1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1552814..1553887
Genome map
AA seq 357 aa AA seqDB search
MNSAAQRPVFPFAALIGQAPLQQALLLAAIDPALGGVLVTGPRGTAKSTAARALAELLPE
GQLVNLPLGASEDRLIGTLDIETVLRDGSVRFSPGLLAKAHRGVLYVDEVNLLPDALVDA
LLDAASSGVNTVERDGVSHSHDASFVLIGTMNPEEGELRPQLIDRFGLMVELQNCFEPSV
RQAIVKARLAFDLDPQGFRAGYAQQQAAYVEQIHAARAALSQLAFDEAVHARVSALCIEA
AVDGLRADLVMLRAARALAAFEQAATVTAEHVDRVAEAVLVHRRHSRESQADHDAREDDA
SAGAVERSSESSSSSARGDAQSADAAGDSDWGYLAPEPSATTHTHVKGVIPLNVKKR
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagcagcccagcggcccgtttttccatttgccgcgctgatcggtcaggcgcct
ttgcagcaggcgctgctgctggccgccatcgatccggcgctgggcggcgtgctggtcacg
gggccgcgcggcacggccaagtcgaccgccgcgcgggcgctggccgagttgttgccggaa
gggcaactggtgaatctgccgctcggcgcgagcgaagatcgtctgatcggcacgctcgat
atcgaaaccgtgctgcgcgatggttcggtgcgtttctcgcccggtctgctcgcgaaggcg
catcgtggcgtgctgtatgtggatgaggtcaacctgctgcccgacgcgctggtcgatgcc
ttgctcgatgcggcgtcgagtggcgtgaataccgtcgaacgcgatggcgtgtcgcatagc
cacgacgcgagcttcgtgctgatcggcacgatgaatccggaagagggtgaattgcggccg
caattgatcgaccgtttcggcttgatggtcgagttgcagaactgtttcgagccgagcgtg
cggcaggcgatcgtgaaggcacgcctcgcgttcgatctcgatccgcagggtttcagggcc
ggttacgcgcaacagcaggcggcttatgttgagcagattcatgcggcgcgcgccgcactg
tcgcaactcgcattcgatgaagccgtacatgcacgggtcagcgcgttgtgtatcgaggcg
gccgtagacggcttgcgcgccgatctcgtgatgctgcgcgcggcgcgtgcgctggcggcg
ttcgagcaggcagccacggtgacggcggagcatgtcgatcgggttgcggaggcggtgttg
gttcatcggcggcattcccgtgagtcgcaagcggatcatgatgcgcgtgaggatgacgct
tccgctggtgctgtggagcggtcgtctgagtcttcatcttcatccgctcgaggcgatgcg
cagtcggccgacgctgccggcgatagcgattggggctacctggcgcccgagccgagcgcg
accacgcacacgcacgtcaaaggcgtcataccgctcaacgtaaaaaaacgctga

DBGET integrated database retrieval system