KEGG   Burkholderia xenovorans LB400: Bxe_B1816Help
Entry
Bxe_B1816         CDS       T00340                                 

Definition
hypothetical protein
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bxe  Burkholderia xenovorans LB400
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Bxe_B1816
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Bxe_B1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1357512..1360970)
Genome map
AA seq 1152 aa AA seqDB search
MNRLSSAVTAIQSHYDVVVVGSGYGGAIAACRMARAGRRVCVLERGREFMAGEFPRTPFQ
GAAQVQYNTAAAHIGSPLALLEVHVNEDVNAVVGCGLGGTSLINANVALEADPRLWDDAR
WPAALRADKAARDKGYALARAMLQPSPVPKDYPVLPKLQALEKSAQALGMEDRFTRPDIT
VTFEDRVNAAGVAQKACVGCGDCNSGCNYDAKNSTHMNYLPDAVAHGAQIFTGTAVHSVR
RDATTRKWIVGYQLVSLGRESYGAPDLFVSADIVIVSAGTIGSTALLLRSRNQGLSVSGM
LGKHFTGNGDVLAFAYNTEPVINGVGWGSHEPGDIPPVGPTITGLIDHRNTANVRDGYVI
EEGSLAGPVGAALVGLLGAAAPLEGVDVAPRSLPEQIAYDARMSESFLRGPYHGALNHTQ
SYLVMAHDDEDGQIDVDDTGQPRIVWENAGKQPIFQVVEEALKQATVPLGGKYLRNPIST
DIIGNRTVTVHPLGGCGMGEDAEHGVVDHMGRVFSGATGNAVHDGLYVMDGAVMPMSLGV
NPLLTISALAERNCELLLATHPVTAAPADGAAATPSLPPAPTPELASSSLTPSSPQKIGL
HFTETMIGTYAPVAAGEAGASPIEFTLTVESEDLADMISNPQHLARTAGTLTCPALSSQP
MTISNGTFNLFVVDESDVDERNMNYRMTLNSTEGKTYYLSGQKIITRTSPVNLWEQTNTL
YAEIRESAQADAPLLGKATLIITPENFLKQQRTLEVTHAPDLKTRLEWTLKFGKFFAGVL
FTEYGGVAAPLQYYDPKAEPRLKRALRAPAPQVVFFDTPDGTTLRLTRYLDPALKAARPV
LLIHGSGVSSRIYSTDLIATNMVEYLCASGYDVWLVDLRVSIEMPSVLVPTNVDKVARED
IPAAVARIRELTGAAEIQALGHCMGGLALSMSLLYGLEGVRSAVISQVSAHPVPGTLQKI
KAGLHIPDLMQHLGVHDLTAYTEHESWPRNLLDEALRFYPLDHDEGCGNPVCHRATFLYG
LLYEHEKLNETLHANLQELLGVHDVSVFKHLAAMVRAGKVVDAAGEDVYLAGADGMKGLE
GMRRPIGFIHGERNETYLPASTLRTYELLTGHFPEQPYERHVIPGYGHIDCIFGKHAAVD
VYPVIAKYLDAH
NT seq 3459 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcttatcgagcgccgtgaccgcaattcaatcgcattacgacgtggtcgtggtg
ggttccggctacggcggcgcgattgccgcgtgccgcatggcgcgcgccgggcgccgcgta
tgcgtgctcgaacgcgggcgcgaattcatggccggcgaattcccccgcacgccgtttcag
ggcgccgcgcaggtgcaatacaacacggcggcggcccatatcggctcgccgctggccttg
ctcgaagtgcacgtgaacgaagacgtgaacgcggtagtcggctgcggtctgggcggcacc
tcgctgatcaacgcgaacgtcgcgctcgaagccgacccgcgcctgtgggacgacgcacgc
tggccggccgcgttgcgtgccgacaaggccgcgcgcgacaaaggctatgcgcttgcccga
gcgatgctgcaaccgtcgccggtgccgaaggattatccggtgttgccgaaactgcaggcg
ctcgaaaaatcggcgcaggcgctcggcatggaagaccgcttcacgcgcccggatatcacc
gtcacgttcgaggaccgcgtgaacgccgcaggcgtcgcgcagaaggcttgcgttggctgc
ggcgactgcaattcgggctgcaattacgatgcgaagaattcgacccacatgaactatctg
cccgacgccgtggcccacggcgcgcagattttcaccggcaccgctgtccattcggtgcgg
cgcgacgcgaccacgcgcaaatggatcgtgggctaccagttggtgagcctcggccgcgaa
agctatggcgcgcccgatctgttcgtgagcgccgatatcgtgatcgtctcggctggcacg
atcggctcgaccgcgctgctgctgcgctcgcgcaatcaggggttgagcgtctccggcatg
ctcggcaaacatttcaccggcaatggcgacgtgctcgcctttgcgtacaacaccgagccc
gtgatcaacggcgtcggctggggttcgcacgagccgggcgatatcccgccggtcggcccg
accattaccggcctcatcgatcatcgcaatacggccaacgtcagggatggctatgtgatc
gaagaaggctcgctggccggtccggtgggcgcggcgctggtcggcctgctcggcgccgcc
gcgccgctcgaaggcgtggatgtcgcgccgcgttcgctcccggaacagatcgcttacgac
gcccgcatgtccgagagctttctgcgcggcccctatcacggcgcgctcaatcacacgcaa
agctacctcgtcatggcgcatgacgacgaagacggccagatcgacgtggacgacacaggc
cagccgcgcatcgtgtgggaaaacgccggcaagcagccgatctttcaggtggtcgaggag
gcgctcaagcaggccaccgtgccgctcggcggcaaatacctgcgcaatccgatctccacc
gatatcatcggcaaccgcaccgtcaccgtgcatccgctcggcggctgcggcatgggcgag
gacgcggagcacggcgtagtcgaccacatgggccgcgtgttcagcggcgccacgggcaac
gcggtgcacgacggcctgtacgtgatggacggcgccgtcatgccgatgtcgctcggcgtc
aatccgctcctcaccatttccgcgctggccgaacgcaattgcgagctgctgctggccacg
catcccgtgaccgccgccccggccgacggcgcggccgccacgccgagcttgccgcctgcg
ccgacgcccgagctcgcgtcgtcgtcgttgacgccgtcctcgccgcagaagatcggcctg
catttcaccgaaacgatgatcggcacctacgcgccggtcgcggcgggcgaagccggcgcg
agtccgatcgagttcacgctgacggtcgaatcggaagatctcgccgatatgatcagcaat
ccgcaacatctggcgcgaaccgccggcacgctgacctgccccgcgctctcgtcgcagccg
atgacgatctccaacggcaccttcaatctgttcgtggtcgacgagtccgacgtggacgag
cgcaacatgaattaccgcatgacgctcaattcgaccgaaggcaagacgtactatctgagc
gggcaaaagatcatcacccgcacctcgccggtcaatctgtgggagcagaccaacacgctc
tacgcggaaatccgcgaatcggcgcaagccgatgcaccgctgctcggcaaggcgacgctc
atcatcacgcccgagaatttcctcaagcagcaacgcacgctcgaagtcacccatgcgccc
gatctgaagacccgcctcgaatggaccctgaaattcggcaagtttttcgcgggcgtgctg
ttcaccgaatacggcggcgtggccgcgcccttgcagtactacgacccgaaggccgagccg
cgcctgaagcgcgcgctgcgcgcgccggcgccgcaggtggtcttcttcgacacgcccgat
ggcacgacgctgaggctcacacgctacctcgatcccgcgctcaaggccgcgcgcccggtg
ctgctgattcacggctccggcgtatcgagccgcatctactccaccgatctgatcgcgacc
aacatggtcgaatatctttgcgcttcaggctacgacgtgtggctcgtcgatctgcgcgtc
agcatcgaaatgccgagcgtgctcgtgccgaccaacgtcgacaaggtggcgcgcgaggac
attccggccgcggtcgccaggatccgcgaactgaccggtgccgcggagattcaggcgctg
ggacactgcatgggtggcctggcactcagcatgtcgctgctgtacggactcgaaggcgtg
cgctcggcggtcatctcgcaggtgtcggcgcacccggtgccgggaacgctgcagaagatc
aaggccggcctgcatattcccgacctcatgcagcatctcggcgtgcacgacctgaccgcc
tatacggaacacgagtcgtggccgcgaaacctgctcgatgaagcgctcaggttctacccg
ctcgatcacgacgagggttgcggcaatccggtctgccaccgcgccacgttcctgtacggc
ctgctctacgaacatgaaaaactcaacgaaacgcttcacgcgaacctgcaggaattgctc
ggcgtgcacgacgtttcggtattcaagcatctcgccgcgatggtgcgagccggtaaagta
gtcgacgcggccggcgaagatgtctatctggccggcgcggacggtatgaaaggcctggaa
ggcatgcgccggccaatcggcttcattcacggggaaaggaacgaaacgtatctgccggca
agcacgctgcgcacgtacgagctgctgaccgggcatttccccgagcagccttacgagcgg
cacgtcattcccggttatggacacatcgactgtatcttcggcaagcacgccgccgtggat
gtttatccggtgatcgcgaagtacctggacgcgcattga

DBGET integrated database retrieval system