KEGG   Burkholderia xenovorans LB400: Bxe_B2042Help
Entry
Bxe_B2042         CDS       T00340                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bxe_B2042
Enzymes [BR:bxe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Bxe_B2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1117584..1118765)
Genome map
AA seq 393 aa AA seqDB search
MRVRINKTIGVALTLGLAASASFGNLVKVAQSTAAPGACGDWSGYRAFVERFVQADGRVI
DYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLGWTRTNLAGNQFDARNMRLPSWQWGK
KADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEAGYTQMGEALAAQIARQEMTTLPGIG
PMLLPGPQGFKNGGVTRLNPSYLPLPVLRALAHEMPDGPWGKLADSAYKLIRTTAPQGFA
PDWAAWQNGQFVVDPKNGDTGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRARVAQTG
IPPEKVSSTTGAASGEGPLSYWGALAPYFKALGDEHGLGLARTHLAALDAAVPGREPVYY
DRVLGLFGTGFIDGRYRFDEAGRLVPSWRNACD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttcgaatcaacaagacaatcggcgtggcgctgacgctcgggctggcggcgtcg
gcaagtttcggcaatctcgtcaaagtggcgcagagcaccgccgcgcccggcgcctgcggc
gactggagcggctaccgcgcattcgtcgaacgcttcgtgcaggccgacggccgcgtgatc
gactactccacgccgacgcagcaaaccacctccgaaggccaatcgtacgggctcttcttc
gcactggtcgcgaacgaccgcgccaccttcgaccggctgctcggctggacccgcaccaat
ctcgcgggcaatcagttcgacgcgcggaacatgcggctgccgtcgtggcaatggggcaaa
aaagcggacggctcatacggtgtgctcgatccgaattccgcgtccgactccgacctgtgg
atcgcctacgatctgctgcaagcgggccgcctgtggcacgaagcgggttatacccagatg
ggcgaagcgctggccgcgcagatcgcacggcaggaaatgaccacgctgccgggcatcgga
ccgatgctgctgcccggaccgcaaggcttcaaaaacggcggcgtgacgcgcctgaatccg
agctatctgccgctgccggtgctgcgcgcgctcgcacacgagatgccggacggtccgtgg
ggcaagctcgccgacagcgcctacaagctgatcaggaccaccgcgccgcaaggcttcgcg
cccgactgggcagcctggcaaaacggccagttcgtggtcgatccgaaaaacggcgacacc
ggcagctacgacgcgatccgcgtctatctgtgggccggtctcgcctcgcccgccgatccg
ctcgccaaaccgtggctcgcggcgctcggcggcatgcgcgcgcgcgtcgcgcaaaccggc
attccgccggagaaggtctcgtcgaccaccggcgcggccagcggcgaagggccgctcagc
tattggggcgcgctcgcgccgtatttcaaggcgctcggcgacgagcacggcctcggcctc
gcgcgcacgcatctggccgcgctcgacgccgccgtgccgggccgcgaaccggtttactac
gatcgtgtgctgggcttgttcggcacgggtttcatcgacggccgctatcgtttcgacgaa
gccggacgtctcgtgccgagctggagaaatgcatgcgattga

DBGET integrated database retrieval system