KEGG   Paraburkholderia xenovorans LB400: Bxe_B2042Help
Entry
Bxe_B2042         CDS       T00340                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bxe  Paraburkholderia xenovorans LB400
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(1117584..1118765)
Genome map
AA seq 393 aa AA seqDB search
MRVRINKTIGVALTLGLAASASFGNLVKVAQSTAAPGACGDWSGYRAFVERFVQADGRVI
DYSTPTQQTTSEGQSYGLFFALVANDRATFDRLLGWTRTNLAGNQFDARNMRLPSWQWGK
KADGSYGVLDPNSASDSDLWIAYDLLQAGRLWHEAGYTQMGEALAAQIARQEMTTLPGIG
PMLLPGPQGFKNGGVTRLNPSYLPLPVLRALAHEMPDGPWGKLADSAYKLIRTTAPQGFA
PDWAAWQNGQFVVDPKNGDTGSYDAIRVYLWAGLASPADPLAKPWLAALGGMRARVAQTG
IPPEKVSSTTGAASGEGPLSYWGALAPYFKALGDEHGLGLARTHLAALDAAVPGREPVYY
DRVLGLFGTGFIDGRYRFDEAGRLVPSWRNACD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttcgaatcaacaagacaatcggcgtggcgctgacgctcgggctggcggcgtcg
gcaagtttcggcaatctcgtcaaagtggcgcagagcaccgccgcgcccggcgcctgcggc
gactggagcggctaccgcgcattcgtcgaacgcttcgtgcaggccgacggccgcgtgatc
gactactccacgccgacgcagcaaaccacctccgaaggccaatcgtacgggctcttcttc
gcactggtcgcgaacgaccgcgccaccttcgaccggctgctcggctggacccgcaccaat
ctcgcgggcaatcagttcgacgcgcggaacatgcggctgccgtcgtggcaatggggcaaa
aaagcggacggctcatacggtgtgctcgatccgaattccgcgtccgactccgacctgtgg
atcgcctacgatctgctgcaagcgggccgcctgtggcacgaagcgggttatacccagatg
ggcgaagcgctggccgcgcagatcgcacggcaggaaatgaccacgctgccgggcatcgga
ccgatgctgctgcccggaccgcaaggcttcaaaaacggcggcgtgacgcgcctgaatccg
agctatctgccgctgccggtgctgcgcgcgctcgcacacgagatgccggacggtccgtgg
ggcaagctcgccgacagcgcctacaagctgatcaggaccaccgcgccgcaaggcttcgcg
cccgactgggcagcctggcaaaacggccagttcgtggtcgatccgaaaaacggcgacacc
ggcagctacgacgcgatccgcgtctatctgtgggccggtctcgcctcgcccgccgatccg
ctcgccaaaccgtggctcgcggcgctcggcggcatgcgcgcgcgcgtcgcgcaaaccggc
attccgccggagaaggtctcgtcgaccaccggcgcggccagcggcgaagggccgctcagc
tattggggcgcgctcgcgccgtatttcaaggcgctcggcgacgagcacggcctcggcctc
gcgcgcacgcatctggccgcgctcgacgccgccgtgccgggccgcgaaccggtttactac
gatcgtgtgctgggcttgttcggcacgggtttcatcgacggccgctatcgtttcgacgaa
gccggacgtctcgtgccgagctggagaaatgcatgcgattga

DBGET integrated database retrieval system