KEGG   Burkholderia xenovorans: Bxe_B2108Help
Entry
Bxe_B2108         CDS       T00340                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bxe  Burkholderia xenovorans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bxe_B2108
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bxe_B2108
Enzymes [BR:bxe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bxe_B2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1042701..1043993)
Genome map
AA seq 430 aa AA seqDB search
MSVPQQAFLRDAMRRLNMTRDTFASRIGVSRRALDTWLLPDDSQESRAMPEIVERFVSEI
VVHGEPGEKHTQSVDSQSLASQMLFEGKPQLLSVDQFSRDSVEALFRVADIMQPIARRRK
ISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVM
SGYVDALVIRHPEQGSVAEFARATNVPVINGGDGPGEHPSQALLDLYTIQREFSRLGKIV
DGAHIALVGDLKYGRTVHSLVKLLALYRGIKFTLISPPMLEMPGYIIEQISRNDHVIEQT
HDLSTGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSVCGVDTLIMHPLPRDS
RPGANDLSVDLNHDSRLAIFRQTDNGIPVRMAIFAVLLGVEKLVQHSMRDAAWRPPVYLG
PDDAVFHGID
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcccgcaacaagccttcctacgcgacgcgatgcgccgcctgaacatgacgcgc
gacacgttcgcgagccgcatcggcgtgtcgcgccgggcgctcgatacctggctcctgccg
gacgactcgcaggaatcgcgggccatgccggaaatcgtggagcgcttcgtgtcggagatc
gtggtgcacggcgagccgggcgaaaaacatacgcagagcgtagactcgcagtcgctcgcg
agccagatgcttttcgagggcaagccgcagttgctctcggtggatcaattctcgcgcgac
tcggtggaggcgctgttccgcgtggccgacatcatgcagccgatcgcccggcgccgcaaa
atctcccgcgtgctggaaggcgcggtgctcggcaatctgttcttcgaagccagcacgcgt
acccgcgtgagcttcggcgcggcgttctgccggctgggcggctcagtttgcgacactacc
ggtttcacgttttcgtcaatggccaagggcgaatcgatctacgacaccagccgcgtgatg
agcggttatgtggacgccctggtaatccgccatccggagcaaggctcggtggccgaattc
gcgcgcgcgaccaatgtgcccgtgatcaacggcggcgacgggccgggcgaacacccgagc
caggcgctgctcgatctgtacaccattcagcgtgagttctcgcgcctcggcaagatcgtc
gacggcgcccatatcgcgctggtcggcgacctgaagtacgggcgcaccgtgcactcgctg
gtcaaattgctggcgctttaccgcggcatcaagttcacgctgatctcgccgcccatgctc
gaaatgcccggctatatcatcgagcagatttcgcgcaacgaccacgtgatcgagcagact
cacgatctgtccaccggcctgcgcggcgccgacgtggtgtacgccacgcgcatccagaaa
gagcgcttcaccgacgaatcgttcgaaggctatacgccggatttccagatcaatcaggcg
ctggtggacagcgtgtgcggcgtcgatacgctgatcatgcacccgctgccgcgcgacagc
cgccccggcgcgaacgatctgagcgtggacctgaaccacgattcacggctggcgatcttc
cggcagaccgacaacggcattccggtgcgcatggcgattttcgcggtgctgctgggcgtg
gagaaactggttcagcattccatgcgcgatgcggcgtggcgcccgccggtctatctcggt
ccggacgacgcggtttttcacggaatcgattga

DBGET integrated database retrieval system