KEGG   Paraburkholderia xenovorans LB400: Bxe_B2326Help
Entry
Bxe_B2326         CDS       T00340                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00360  Phenylalanine metabolism
bxe00362  Benzoate degradation
bxe00620  Pyruvate metabolism
bxe00621  Dioxin degradation
bxe00622  Xylene degradation
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
bxe01120  Microbial metabolism in diverse environments
bxe01220  Degradation of aromatic compounds
Module
bxe_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_B2326
   00650 Butanoate metabolism
    Bxe_B2326
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bxe_B2326
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_B2326
   00622 Xylene degradation
    Bxe_B2326
   00621 Dioxin degradation
    Bxe_B2326
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bxe_B2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABE33662
JGI: BxeB2326
UniProt: Q13QH7
Position
2:806260..807201
Genome map
AA seq 313 aa AA seqDB search
MASEKLKAAIIGSGNIGTDLMIKIMRHSEHLEMAAMVGIDAASDGLARAARLGVATTHEG
VEGLTRLPVFDDIDFVFDATSAGAHVKNDAFLRALKPGIRLIDLTPAAIGPYCVPVVNLD
AHLDSRNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SKAIEAVGGAAKGKAIIVLNPAEPPVMMRDTVYVLSDLADRAQVEASIEAMAAAVHAYVP
GYRLKQKVQFDEIAADVPLNIPGLGRFSGLKTSVFIEVEGAAHYLPAYAGNLDIMTSAAL
ATAERMAQSLVQA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgaaaaactcaaggctgcgatcatcggctccggcaacatcggcaccgatctg
atgatcaagatcatgcggcacagcgaacacctggagatggcggcaatggtcggtatcgac
gcggcgtccgatgggctcgcgcgcgccgcgcggctcggcgtcgccaccacgcacgaaggc
gtggaaggcctgacgcgcctgccggtgttcgatgacatcgacttcgtgttcgacgccacc
tcggccggcgcccatgtgaagaacgacgcgtttctgcgcgcgctgaaacccggcatccgg
ctgatcgacctgacgcctgccgcgatcggtccgtactgcgtgccggtcgtgaatctcgac
gcacatctggacagccgcaacgtcaacatggtgacgtgcggcggtcaggcaacgattccg
atggtggccgcggtctcgcgcgtggcgaaggtgcactacgcggaaatcgttgcgtcgatc
agcagcaaatcggccggtcccggcacgcgcgcgaatatcgacgagttcaccgaaaccacc
tcgaaggcaatcgaggccgtgggcggcgcggccaaaggcaaggcgatcatcgtgctcaat
ccggccgagccgccggtgatgatgcgcgacacggtctacgtgctgtcggatctcgccgac
cgcgcgcaggtggaagcctcgatcgaagcgatggccgctgccgtgcatgcgtatgtgccg
ggttaccgtctgaagcagaaagtgcagttcgacgaaatcgccgccgacgtgccgctgaac
attccgggccttggccgcttcagcggtttgaagacctcggtgttcatcgaggtcgaaggc
gcggcgcattacctgccggcttatgcgggcaatctcgacatcatgacctcggccgcgctc
gcgaccgctgagcgcatggcgcaatccctcgtgcaggcttaa

DBGET integrated database retrieval system