KEGG   Burkholderia xenovorans LB400: Bxe_B2326Help
Entry
Bxe_B2326         CDS       T00340                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bxe_B2326
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_B2326
   00650 Butanoate metabolism
    Bxe_B2326
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bxe_B2326
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_B2326
   00622 Xylene degradation
    Bxe_B2326
   00621 Dioxin degradation
    Bxe_B2326
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bxe_B2326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:806260..807201
Genome map
AA seq 313 aa AA seqDB search
MASEKLKAAIIGSGNIGTDLMIKIMRHSEHLEMAAMVGIDAASDGLARAARLGVATTHEG
VEGLTRLPVFDDIDFVFDATSAGAHVKNDAFLRALKPGIRLIDLTPAAIGPYCVPVVNLD
AHLDSRNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASISSKSAGPGTRANIDEFTETT
SKAIEAVGGAAKGKAIIVLNPAEPPVMMRDTVYVLSDLADRAQVEASIEAMAAAVHAYVP
GYRLKQKVQFDEIAADVPLNIPGLGRFSGLKTSVFIEVEGAAHYLPAYAGNLDIMTSAAL
ATAERMAQSLVQA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgaaaaactcaaggctgcgatcatcggctccggcaacatcggcaccgatctg
atgatcaagatcatgcggcacagcgaacacctggagatggcggcaatggtcggtatcgac
gcggcgtccgatgggctcgcgcgcgccgcgcggctcggcgtcgccaccacgcacgaaggc
gtggaaggcctgacgcgcctgccggtgttcgatgacatcgacttcgtgttcgacgccacc
tcggccggcgcccatgtgaagaacgacgcgtttctgcgcgcgctgaaacccggcatccgg
ctgatcgacctgacgcctgccgcgatcggtccgtactgcgtgccggtcgtgaatctcgac
gcacatctggacagccgcaacgtcaacatggtgacgtgcggcggtcaggcaacgattccg
atggtggccgcggtctcgcgcgtggcgaaggtgcactacgcggaaatcgttgcgtcgatc
agcagcaaatcggccggtcccggcacgcgcgcgaatatcgacgagttcaccgaaaccacc
tcgaaggcaatcgaggccgtgggcggcgcggccaaaggcaaggcgatcatcgtgctcaat
ccggccgagccgccggtgatgatgcgcgacacggtctacgtgctgtcggatctcgccgac
cgcgcgcaggtggaagcctcgatcgaagcgatggccgctgccgtgcatgcgtatgtgccg
ggttaccgtctgaagcagaaagtgcagttcgacgaaatcgccgccgacgtgccgctgaac
attccgggccttggccgcttcagcggtttgaagacctcggtgttcatcgaggtcgaaggc
gcggcgcattacctgccggcttatgcgggcaatctcgacatcatgacctcggccgcgctc
gcgaccgctgagcgcatggcgcaatccctcgtgcaggcttaa

DBGET integrated database retrieval system