KEGG   Burkholderia xenovorans: Bxe_B2622Help
Entry
Bxe_B2622         CDS       T00340                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bxe  Burkholderia xenovorans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bxe_B2622
   00051 Fructose and mannose metabolism
    Bxe_B2622
Enzymes [BR:bxe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Bxe_B2622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:462463..463785
Genome map
AA seq 440 aa AA seqDB search
MSYFEHIPEIRYEGPQSDNPLAYRHYDKSKKVLGKTLEEHLRIAVCYWHTFVWPGVDIFG
QGTFRRPWQQAGDAMERARQKADSAFEFFSKLGTPYYTFHDTDVSPEGSSLKEYSENFLR
ITDYLARKQEDTGIKLLWGTANLFSHPRYAAGAATSPDPEVFAFAATQVRHALDATQRLG
GDNYVLWGGREGYDTLLNTDLMRERDQLARFLHMVVDHAHKIGFKGSLLIEPKPQEPTKH
QYDYDVATVHGFLLQHGLEKEIRVNIEANHATLAGHSFHHEIATAYALGIFGSVDANRGD
PQNGWDTDQFPNSVEELTLAFYEILKHGGFTTGGMNFDSKVRRQSVDPEDLFYGHIGAID
NLALAVERAAVLIENDRLDQFKRQRYAGWDADFGRKILSGDYSLSTLATDALARGLNPQH
ASGHQELMENIVNQAIYSGR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcctatttcgaacacattcccgagatccgctacgaaggcccacaatcggacaacccg
cttgcctatcgccactacgataaaagtaaaaaggtactcggtaaaaccctcgaagaacat
ctgcgcattgcggtgtgctattggcacacattcgtttggccgggcgtggatattttcggg
cagggaacgtttcggcgtccctggcagcaagccggcgatgcaatggagcgggcacggcag
aaggcggactccgcattcgagttcttctcgaagctcggtacgccgtactacacgtttcac
gataccgacgtctcgcccgaaggttcgagcctgaaggaatacagcgaaaacttcctgcgc
attacggattatctggcacgcaagcaggaggacaccggcatcaagctgctgtggggcacg
gccaatctgttttcgcatccccgttacgcggccggcgcggccaccagccccgatccggag
gtgttcgcgtttgcggcgacgcaggtgcgccacgcgctcgatgcgacccagcggttaggc
ggcgacaactacgtcctgtggggcggccgcgagggttacgacacgttgctcaataccgac
ctcatgcgtgagcgcgatcaacttgcccgttttctgcatatggtcgtggaccatgcgcac
aagatcggctttaaaggctcgctgctgatcgaacccaagccgcaggaaccgaccaagcat
caatacgattacgatgtcgcaaccgtacacggtttcctgctgcaacacgggttggagaaa
gagatccgggtaaacatcgaggccaatcacgcaacgctcgcgggtcactcgtttcatcac
gagatcgccacggcctatgcgctgggtattttcggcagcgtcgacgcgaatcgcggcgac
ccgcaaaacggctgggataccgaccagttcccaaatagtgtggaagagttgacgcttgcc
ttctacgaaattctcaaacacggcggcttcaccacgggcggcatgaacttcgactcgaaa
gtgcggcgccagagtgtcgatccggaagatctgttctacggccacatcggtgcaatcgat
aacctcgcgctcgccgtcgagcgcgcggcggtgctgatcgaaaacgaccgcctcgatcaa
ttcaagcgtcaacgctatgcgggttgggacgcagactttggacgcaagatcctgtccggc
gactattcgctctccacgctggcaacggatgcgctcgcgcgcggtctgaacccgcagcat
gcaagcggccaccaggagctcatggaaaacatcgtgaatcaggctatttacagcggacgc
tga

DBGET integrated database retrieval system