KEGG   Burkholderia xenovorans: Bxe_B2624Help
Entry
Bxe_B2624         CDS       T00340                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bxe00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bxe00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(459897..461012)
Genome map
AA seq 371 aa AA seqDB search
MPLPFYSTDDMISIAQVSSEPWGTLHGGDSVRLFTLRNAHGMKVAISDLGATLVSWHAPD
RAGVLGDILLGHDTPAEYVAATTYMGALIGRWANRIADARFTLDGIEYTLDRNDGTNLLH
GGTTGFHRALWEAGEDNGALLMRLESPEGDAGFPGNVTAQVRYSLDDDGTLTIAYEAITD
AATPLNLTSHPYFNLTGRPGADIRGHMLSIDADRFFEVDATMIPCKLAEVAGNAFDFRRS
APIGARLDWPHAQLATAGGFDHCYVLRDTRDTGMNGATPPMREVACAYDPGSGRELTVST
DQRGLQFYTGNSLNGDTGRGGIAYQPHAGLCLEAGGFPNQVNMAEQDEVIVRAGSTYRQV
TAYRVDVRKGI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcctttacctttttattccaccgacgacatgatcagcatcgcacaagtttcttccgaa
ccgtggggcacattacacggcggcgattccgtccggctcttcacgctgcgcaacgcacac
ggcatgaaagtcgccatcagcgatctgggcgcgacgctggtgtcgtggcatgcgccggat
cgcgcgggcgtgctcggcgatatcctgctcggccacgacacgcccgccgagtacgtggcc
gccaccacttatatgggcgcactgataggccgctgggcgaaccgcattgccgatgcacgc
ttcacgctcgacggtatcgaatacacactcgaccgtaacgacggcacgaacctgctgcat
ggcggcacgacgggatttcatcgcgcgctgtgggaagcgggcgaagacaatggcgcgctg
ctcatgcggctggagtcgcccgaaggcgacgccggttttccgggcaacgtgactgcgcaa
gtgcgctactcgctcgacgacgacggcacgctgaccatcgcctatgaagcgatcaccgac
gccgccacgccgctcaatctgacaagccatccgtacttcaacctcacgggccggcccggc
gcggatattcgcggccatatgctgtcgatcgacgccgaccggttctttgaagtggacgcc
accatgattccatgcaagctcgcggaggtagcaggcaacgcattcgacttccggcgcagc
gcgccgatcggtgcgcggttggactggccgcacgcgcaattggcaacggcgggcggcttc
gatcattgctatgtactgcgcgatacgcgtgacaccggcatgaacggcgccacgccgccc
atgcgcgaggttgcctgcgcttatgatcccggcagcggacgcgaattgacggtgtcgacc
gatcagcgcggcttacagttctataccggtaattcgctgaatggcgatacgggacgcggc
ggcattgcatatcaaccacacgccggtttatgtctcgaagcaggcggcttcccgaaccag
gtcaatatggctgagcaggacgaagtgatcgtgcgcgccggcagcacctatcggcaagta
accgcctatcgggtagatgtgcgcaagggcatataa

DBGET integrated database retrieval system