KEGG   Burkholderia xenovorans: Bxe_B2831Help
Entry
Bxe_B2831         CDS       T00340                                 

Definition
3-mercaptopyruvate sulfurtransferase (EC:2.8.1.1)
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
bxe  Burkholderia xenovorans
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bxe_B2831
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bxe_B2831
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Bxe_B2831
Enzymes [BR:bxe01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     Bxe_B2831
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     Bxe_B2831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(231794..232663)
Genome map
AA seq 289 aa AA seqDB search
MPHTHYTTLISAANLAERLAAAPGSVFVIDCRFDLADPEAGEKAYLAGHLPGAHYLHLDR
DLSGPKNGQNGRHPLPDRARLVETLESRGLKQGQQVVAYDAQGGMYAARAWWLLRWLGHD
AVALLDGGLQAWEAGGYPLTQDAPAQNTGDFKAGAPLSVTVDAQTVERNLGSKERVVVDA
RAADRYRGENETLDRVGGHIPGALNRFFKDNLTADNRFKPAHTLREEFHALLAGTPPEHV
ILQCGSGVTACVNALAMEVAGLHGAALYAGSWSEWSSDPKRPVATGPNP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccccacactcattacaccactctgatctccgcggccaatctcgcggaacggctcgcc
gccgcgccgggcagcgtgttcgtcatcgattgccggttcgatctggccgacccggaggcg
ggcgaaaaagcctatctggccgggcatctgccgggcgcgcattacctgcatctcgatcgc
gatctgtcggggccgaagaacggccagaacggccgccatccgttgccggatcgtgcgcgg
ctggtggagacgctggagtcgcgcggcctgaaacaagggcagcaggtcgtcgcctatgac
gcacaaggcggcatgtacgccgcccgcgcatggtggctgctgcgctggctcggtcacgac
gcggtcgcgctgctcgacggcgggctgcaggcatgggaggcaggcggttatccgctgacg
caggacgcgcccgcccagaacaccggcgacttcaaagccggcgcgccgctgtcggtcacg
gtcgacgcgcaaacggtcgagcgcaatctgggttcgaaggaacgcgtggtggtcgacgcg
cgcgccgccgaccgttatcgcggtgagaacgagacactggatcgcgtcggcggccacatt
cccggggcgctcaaccgcttcttcaaagacaacctcaccgccgacaaccgcttcaagccg
gctcacacgctgcgcgaggaattccacgcgctgctcgccggcacgccgccggaacacgtg
atactgcaatgcggctcgggcgtgacggcctgcgtgaatgcgctggcgatggaagtcgcc
ggcctgcacggcgcggccttgtacgcgggatcatggagcgaatggagttcggatccaaag
cgccccgtcgcaactggcccgaatccttga

DBGET integrated database retrieval system