KEGG   Burkholderia xenovorans LB400: Bxe_B2866Help
Entry
Bxe_B2866         CDS       T00340                                 

Definition
glycoside hydrolase family protein (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bxe_B2866
Enzymes [BR:bxe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Bxe_B2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(188052..190262)
Genome map
AA seq 736 aa AA seqDB search
MITRRHNDTIVNLAARAGFEVEWQDAHHTTQHVPENTLAVLLERMGLPCGNATQIRQSSA
VLEAELSGRKLPPLMTAEVGRGIALPAAAIRSGSHYRIELESGSIIDGRFTAPKGEEALL
APIDEPGYHTLVINEQRVTLAVAPPRCYTVADAWRTLHDDGDGHDKTAPPLWGIAAQLYG
LRRIGDGGIGDYSALAQIAVESAKRGAHALAVSPTHAMFSAEPNRFSPYSPSSRLWLNVT
HIDPAAVFGTDAAHAALEAAQAGDAWSKLEDLPLIDWPGAVVLKLKVLRALYEQFCVKER
AQNTPRALEFHGFCERAGRALEDHARFEALQAAQLSQEGGNGHWRNWSEALRDPRSPEVE
AFAEANRHEVDFHLFLQWLAAKGLSHAQHAAREAGMAVGLIADLAVGCDSAGSHAWSYRD
DMLQGVSVGAPPDLFNQAGQAWGLTTFSPRAMRMQGFSAFIDMLRAAFAHAGGIRIDHIL
GLRRLWLVPEGESARNGAYLRYPLEDLLRLIALESWRHRAIVIGEDLGTVPPGFRERLEE
HGIAGIRVLWFESAHDGKGFKPPRAWDRNAVGTTTTHDLPTVAGWWRGSDITWRNRIGQT
MARADGRDPEEAAQEERAKDRALLWHAFQQAGVAAHDVPAPPPDSAPVDEALAFVAATPG
PLVTFPLEDLLAQVEQPNLPGSIDEHPNWRRRVTLPVDELFQDDTFCDRLLAVDRERRAA
AASVPSSNAYSEPDTP
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
gtgattacccgacgccataacgacaccatcgtcaatcttgccgcgcgcgccggtttcgag
gtggagtggcaggacgcgcaccatacgacgcaacatgtgcccgagaacacgctcgccgtg
ctgctcgaacggatgggtttgccgtgcggcaacgcgacgcaaatccgccaaagctctgct
gtgctggaggccgaactgtcgggccgcaaactgccgccgctgatgaccgcggaggttgga
cgcggcatcgcgctgcccgccgccgcgatcagatcgggcagccactaccggatcgagctc
gaaagcggctcgatcatcgacggccggttcacggcgcccaaaggcgaggaagcgctgctt
gcaccgatcgacgagccgggctatcacacgctcgtgatcaacgagcaacgcgtgacgctc
gccgtcgcgccgccgcgctgctacaccgtcgccgacgcgtggcgcacgctgcacgatgac
ggcgacggccacgacaaaaccgcgccgccgctgtggggcatcgccgcgcagttgtacggc
ttgcgccgcatcggcgacggcggcatcggcgactattcggcgcttgcgcagatcgccgtc
gaaagcgcgaagcgtggcgcgcacgcgctcgccgtcagcccgactcacgcgatgttcagc
gcggaaccgaaccgcttcagtccgtattcgccatcgtcgcgtttgtggctgaacgtcacg
catatcgatcccgccgccgtgttcggcacggacgcggcccacgccgcgctcgaagccgcg
caggccggcgacgcctggtcgaaactcgaagacctgccgttgatcgactggccgggcgcg
gtcgtcctgaagctgaaggttttgcgcgcgctgtacgagcagttctgcgtgaaggaacgc
gcgcagaacacgccgcgcgcgctggaatttcacggcttctgcgaacgggcgggacgcgcg
ctcgaagatcacgcgcgcttcgaagcgctgcaggcggcgcaactctcgcaagaaggcggc
aatgggcattggcgtaactggtccgaggcgctacgcgatccgcgcagcccggaagtcgaa
gcttttgccgaggcgaatcgtcacgaggtcgatttccatctgtttctgcagtggcttgcc
gccaagggtttgtcgcacgcgcagcacgcggcgcgcgaagccggcatggccgtcggcctg
atcgccgacctcgcggtgggctgcgacagcgccggcagtcacgcgtggtcatatcgcgac
gacatgctgcaaggcgtgtcggtcggcgcgccgccggacctgttcaaccaggccggccag
gcatgggggctcaccacgttctccccgcgcgccatgcgcatgcagggcttttccgccttc
atcgacatgctgcgcgcggccttcgcgcatgccggcggcatccgcatcgatcacattctc
ggcttgcggcggctgtggctcgtgccggaaggcgaaagcgcgcgtaacggcgcgtacttg
cgctatccgctcgaagatctgctgcgtctgatcgcgctcgaatcgtggcggcaccgcgca
atcgtaataggcgaagatctgggcaccgtgccgcccggtttccgcgagcggctcgaagag
cacggcattgccggcattcgcgtgctgtggttcgaaagcgcgcacgacggcaaggggttc
aagccgccccgagcctgggaccgcaatgcggtcggcaccacgaccacgcacgatctgccg
acggtcgccggctggtggcgcggcagcgacatcacgtggcgcaaccggatcggccagacg
atggcgcgcgccgacggccgcgatcccgaggaagccgcccaggaagagcgcgcgaaagat
cgcgcattgctgtggcacgcgttccagcaggccggcgtggccgcgcacgacgtccctgcg
ccgccgcccgacagcgcgccggtggacgaagcgctcgccttcgtggccgccacgcccggc
ccgctggtgacgtttccgctagaggatctgctcgcgcaggtcgagcagccgaatctgccc
ggctcgatcgacgagcatccgaactggcgccgccgcgtcaccttgccggtcgacgaactg
ttccaggacgacaccttctgcgaccgcctgctcgcggtcgatcgcgagcgccgcgccgcg
gccgcctcagttccttcttccaacgcttattcggagcctgatacgccatga

DBGET integrated database retrieval system