KEGG   Paraburkholderia xenovorans LB400: Bxe_B2879Help
Entry
Bxe_B2879         CDS       T00340                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00260  Glycine, serine and threonine metabolism
bxe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01130  Biosynthesis of antibiotics
bxe01230  Biosynthesis of amino acids
Module
bxe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_B2879
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bxe_B2879
Enzymes [BR:bxe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bxe_B2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 BtpA PcrB His_biosynth KDGP_aldolase
Motif
Other DBs
NCBI-ProteinID: ABE33116
JGI: BxeB2879
UniProt: Q13S23
Position
2:172335..173180
Genome map
AA seq 281 aa AA seqDB search
MLRSNSIREYSMSRIKNTFAALSAQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIE
LGVPFSDPMADGPVIQQSSERALAQGVSLRHVIADVKRFRETNDTTPVVLMGYANPIERM
GTEAFARAAKEAGVDGVLVVDYPPEECANFAEQMRSAGIDPIFLLAPTSTDERIAEVGKI
ASGYVYYVSLKGVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAQTARAVAEVSDA
VVIGSRIVQLLEQAAPESAAATLTRFIAEVREALDSVATAR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcagtaactcaatccgagaatattccatgtcccgtatcaagaacacgtttgct
gcgctgtccgcccaaggcaagaaaggcctgattccgttcatgacggccggcgacccggac
ccggcccgcaccgtcgaattcatgcatgcgctcgccgccggcggcgcggatgtgatcgaa
ctcggcgtaccgttttccgacccgatggccgatggcccggtcatccagcagtcgtcggag
cgggcgttggcgcaaggcgtgtcgctgcgccatgtgattgccgacgtcaagcgcttccgc
gaaaccaacgacacgacgcccgtagtactaatgggctacgccaatccgatcgagcgcatg
ggcaccgaggcttttgccagggcagcaaaggaggctggcgtggacggcgtgctggttgtc
gactatccgccggaagaatgtgctaacttcgccgaacagatgcgatctgcgggcatcgac
ccgattttcctgctggcgcccacttcaaccgacgaacgcatcgcggaagtcgggaaaatc
gccagcggctacgtctattacgtgtcgttgaaaggcgtgaccggagcggcaaatctggac
gtttccagcatcgcgagtaaaatcccggccatcaagtcgcgcgtccccctgccggtgggc
gtcggtttcggtatacgcgacgcgcagacagcgcgtgcggtggccgaagtgtccgatgcc
gtcgtgatcggcagccgtatcgtgcaattgctggaacaggcggcgccggaaagcgctgcc
gctacgcttacgcgtttcatcgcagaagtgcgcgaggcgctggacagcgtcgcgactgcc
cgataa

DBGET integrated database retrieval system