KEGG   Burkholderia xenovorans LB400: Bxe_B2879Help
Entry
Bxe_B2879         CDS       T00340                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bxe_B2879 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_B2879 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bxe_B2879 (trpA)
Enzymes [BR:bxe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bxe_B2879 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:172368..173180
Genome map
AA seq 270 aa AA seqDB search
MSRIKNTFAALSAQGKKGLIPFMTAGDPDPARTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQQSSERALAQGVSLRHVIADVKRFRETNDTTPVVLMGYANPIERMGTEAFARAAKE
AGVDGVLVVDYPPEECANFAEQMRSAGIDPIFLLAPTSTDERIAEVGKIASGYVYYVSLK
GVTGAANLDVSSIASKIPAIKSRVPLPVGVGFGIRDAQTARAVAEVSDAVVIGSRIVQLL
EQAAPESAAATLTRFIAEVREALDSVATAR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtatcaagaacacgtttgctgcgctgtccgcccaaggcaagaaaggcctgatt
ccgttcatgacggccggcgacccggacccggcccgcaccgtcgaattcatgcatgcgctc
gccgccggcggcgcggatgtgatcgaactcggcgtaccgttttccgacccgatggccgat
ggcccggtcatccagcagtcgtcggagcgggcgttggcgcaaggcgtgtcgctgcgccat
gtgattgccgacgtcaagcgcttccgcgaaaccaacgacacgacgcccgtagtactaatg
ggctacgccaatccgatcgagcgcatgggcaccgaggcttttgccagggcagcaaaggag
gctggcgtggacggcgtgctggttgtcgactatccgccggaagaatgtgctaacttcgcc
gaacagatgcgatctgcgggcatcgacccgattttcctgctggcgcccacttcaaccgac
gaacgcatcgcggaagtcgggaaaatcgccagcggctacgtctattacgtgtcgttgaaa
ggcgtgaccggagcggcaaatctggacgtttccagcatcgcgagtaaaatcccggccatc
aagtcgcgcgtccccctgccggtgggcgtcggtttcggtatacgcgacgcgcagacagcg
cgtgcggtggccgaagtgtccgatgccgtcgtgatcggcagccgtatcgtgcaattgctg
gaacaggcggcgccggaaagcgctgccgctacgcttacgcgtttcatcgcagaagtgcgc
gaggcgctggacagcgtcgcgactgcccgataa

DBGET integrated database retrieval system