KEGG   Paraburkholderia xenovorans LB400: Bxe_B2881Help
Entry
Bxe_B2881         CDS       T00340                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bxe_B2881
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bxe_B2881
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bxe_B2881
Enzymes [BR:bxe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bxe_B2881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:170208..171401
Genome map
AA seq 397 aa AA seqDB search
MYNLPDERGHFGQFGGTFVAETLVHALDELRAAYGKYQKDPDFVAEYERELKYFVGRPSP
IYHAQRWSDMLGGAQIFLKREDLNHTGAHKINNVIGQALLAKRMGKPRVIAETGAGQHGV
ATATIAARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNVEDTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELVGRQPDAVIACVGGGSNA
MGIFYPYIDDASVKLIGVEAAGDGIETGRHAASLIGGSPGVLHGNRTYLLQDENGQIIET
HSVSAGLDYPGVGPEHAWLKESKRAEYVGITDEEALKAFHDCCRIEGIIPALESSHALAY
ATKLAPTLPKDKYLLVNLSGRGDKDMHTVAERSGIQF
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataacttgcctgacgaaagaggccatttcggccagtttggcggcacgttcgtcgct
gaaacgctggttcacgcgctcgacgagctgcgggcggcgtacgggaaatatcagaaagac
cctgatttcgtcgcggaatacgagcgcgaattgaagtatttcgtcggccgtccgtcgccg
atctatcacgcacagcgctggagcgacatgctcggcggcgcgcagattttcctcaaacgc
gaggatttgaaccacacaggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaaaccgcgcgtaatcgcggaaaccggcgccggccagcacggcgtg
gccacggccaccatcgccgcgcgtttcggcatggagtgcgtcgtctatatgggcgccgag
gacgtgcgccgccaagccgccaacgtgtaccgcatgaagttgctgggcgcgactgtcgtg
ccggtcgagtcgggctcgcgtaccctgaaggacgcattgaatgaagccatgcgcgattgg
gtgactaacgtcgaagacacgttctatatcatcggcaccgtggcaggaccgcacccgtat
ccgatgatggtgcgcgatttccagcgtgtgatcggcgacgaatgcaaggtgcagatgccg
gagctggtcggtcgtcagccggatgcagtgatcgcgtgcgttggcggcggttcgaatgca
atggggatcttttacccctatattgacgacgcttccgtgaaattgatcggcgttgaagcg
gccggcgacggcatcgaaaccggtcgccacgctgcttcgctgatcggcggaagtcccggc
gtgctgcacggcaaccgcacctacctgcttcaggacgaaaatggccagatcatcgaaacc
cattcggtgtcggcgggcctcgattatcccggcgtcggtcctgagcacgcgtggctaaaa
gagagcaaacgcgcggaatatgtcggcatcaccgacgaagaagcgctcaaggcgtttcac
gattgctgccgcatcgagggcattattccggcgctggaatccagccacgcgctggcctac
gccacgaagctcgcgccgacgctgccgaaggacaaataccttctggtcaatctgtcgggc
cgcggcgacaaggacatgcatacggtcgccgagcgatcgggcattcagttctga

DBGET integrated database retrieval system