KEGG   Paraburkholderia xenovorans LB400: Bxe_B2894Help
Entry
Bxe_B2894         CDS       T00340                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00020  Citrate cycle (TCA cycle)
bxe00190  Oxidative phosphorylation
bxe00650  Butanoate metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01200  Carbon metabolism
Module
bxe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bxe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bxe_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bxe_B2894
   00650 Butanoate metabolism
    Bxe_B2894
  Energy metabolism
   00190 Oxidative phosphorylation
    Bxe_B2894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABE33101
JGI: BxeB2894
UniProt: Q13S38
Position
2:155959..156327
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGPKRLVVGAHYGLRDWLAQRITACVMAIYTVILLVWFFGARDFSYEGWSSIFA
TQWMKLATFVTLLSLFYHAWVGIRDIWMDYVKPVGTRLFLQALTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagctaataaccgaatcggtccgaagcgtctcgtcgtcggcgcacattacggtctg
cgcgactggctcgcccagcgcattactgcctgcgtgatggcgatctacacggtaatcctg
ctcgtctggttcttcggcgcgcgcgatttctcgtatgaaggctggtcgtcgatcttcgcg
acgcaatggatgaaactcgccacgtttgtcacgctgctctcgctgttctatcacgcgtgg
gttggtatccgcgacatctggatggactatgtgaagcccgttggcacgcgcctgttcctt
caggcgctgacgatcgtctggctgctcgcatgtgcgggctacgctgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system