KEGG   Burkholderia xenovorans LB400: Bxe_C0240Help
Entry
Bxe_C0240         CDS       T00340                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bxe_C0240
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bxe_C0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(261314..261706)
Genome map
AA seq 130 aa AA seqDB search
MSYYGCARVILRIGCCGALGFGWGMASADSVAPAQAFERCAACHGVAQGDQRVGPSLGDV
LGRQAGSMEGFRYSSAMRSSGIVWTAQSLELFLKDPQRAVPGNRMAFSGVDDAPTRDAIV
DYLREHSQAR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattacggatgcgcacgcgtcatcttgcggatcggctgttgcggtgcactgggc
ttcggatggggaatggcaagcgcggactccgttgcgccggcccaggcgttcgagcgttgc
gctgcctgtcatggcgtcgcacagggcgatcagcgagtgggcccgagtcttggcgacgtg
ctcggccgtcaggccggatcaatggaaggtttccgctattcatcggcgatgcggagcagc
ggcatcgtctggaccgcgcaaagcctcgagctgtttctcaaagatccgcaacgcgcggtg
ccgggcaaccggatggccttctcgggcgtcgacgacgcaccgacgcgcgacgcgatcgtc
gactatctgcgcgagcattcgcaagcgcgatga

DBGET integrated database retrieval system