KEGG   Burkholderia xenovorans: Bxe_C0240Help
Entry
Bxe_C0240         CDS       T00340                                 

Definition
putative cytochrome c
Orthology
K08738  
cytochrome c
Organism
bxe  Burkholderia xenovorans
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bxe00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bxe02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(261314..261706)
Genome map
AA seq 130 aa AA seqDB search
MSYYGCARVILRIGCCGALGFGWGMASADSVAPAQAFERCAACHGVAQGDQRVGPSLGDV
LGRQAGSMEGFRYSSAMRSSGIVWTAQSLELFLKDPQRAVPGNRMAFSGVDDAPTRDAIV
DYLREHSQAR
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattacggatgcgcacgcgtcatcttgcggatcggctgttgcggtgcactgggc
ttcggatggggaatggcaagcgcggactccgttgcgccggcccaggcgttcgagcgttgc
gctgcctgtcatggcgtcgcacagggcgatcagcgagtgggcccgagtcttggcgacgtg
ctcggccgtcaggccggatcaatggaaggtttccgctattcatcggcgatgcggagcagc
ggcatcgtctggaccgcgcaaagcctcgagctgtttctcaaagatccgcaacgcgcggtg
ccgggcaaccggatggccttctcgggcgtcgacgacgcaccgacgcgcgacgcgatcgtc
gactatctgcgcgagcattcgcaagcgcgatga

DBGET integrated database retrieval system