KEGG   Paraburkholderia xenovorans LB400: Bxe_C0527Help
Entry
Bxe_C0527         CDS       T00340                                 

Definition
(GenBank) Putative Zinc-containing alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00010  Glycolysis / Gluconeogenesis
bxe00071  Fatty acid degradation
bxe00350  Tyrosine metabolism
bxe00625  Chloroalkane and chloroalkene degradation
bxe00626  Naphthalene degradation
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
bxe01120  Microbial metabolism in diverse environments
bxe01130  Biosynthesis of antibiotics
bxe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_C0527
  Lipid metabolism
   00071 Fatty acid degradation
    Bxe_C0527
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_C0527
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bxe_C0527
   00626 Naphthalene degradation
    Bxe_C0527
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bxe_C0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABE36427
JGI: BxeC0527
UniProt: Q13HL2
Position
3:544348..545382
Genome map
AA seq 344 aa AA seqDB search
MKTHMQAAVVEQFGKPLVLKELAIPTPGPGQVLVKTEACGVCHTDLHATNGDWPLKPGLP
FTPGHEGIGIVAALGAGVTAVKEGDRIGVPWLYSACGHCEYCLAAREPVCAEAQFGGYTK
NGGFAEYIVADPNYVAHIPAGLAAREAAPLICAGITSYKGIKETQARPGEWVVISGVGGL
GHLGIQYAKAMGLQVCAVDIDDGKLAHAKRLGADAVVNANDGDPIAAVIRATGGGAHGVL
ITAPSLGAFKQGVGMTRKCGTCVLVGLPPGEFPTPLFDVVANCITIRGSFVGNRRDMAEA
LAFAADGKVRADIELQPLSAINNVFQRLGHGDVPSRVVLEFASH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcacatgcaagccgctgtggtcgaacagttcggcaagccgctggtactgaag
gagctcgccattccgacaccgggtccgggccaggtgctggtcaagaccgaggcctgcggc
gtatgccataccgatctgcatgcgaccaacggcgactggccgctcaagcccggtttgcca
ttcacgccggggcatgagggtattggtattgtcgccgccctcggcgcgggtgtgacggcg
gtgaaggagggcgaccggatcggcgtgccctggctgtattccgcctgtgggcactgcgag
tactgccttgcggcacgcgagcccgtctgcgccgaagcacagttcggcggctacacgaag
aacggcggctttgccgaatacatcgtggctgacccgaactacgtcgctcacataccggca
ggtctggctgcccgcgaagcagcaccgctcatctgcgccggcatcacttcgtacaagggc
atcaaggagacccaggcgcggccgggtgaatgggtcgtgatctcaggcgtcggcggacta
gggcacctgggtatccagtacgccaaagcgatgggcttgcaggtgtgcgccgtcgatatc
gacgacggcaagctagcccatgcgaaacgcctcggcgccgacgccgtggttaatgcgaac
gacggcgacccgattgccgccgtgataagggccactggcggcggcgcgcatggcgtgctg
attacggcgccctctcttggggcgttcaaacagggcgtcggcatgacgcgcaaatgcggt
acctgcgtgctggtcggactgccgccgggtgaattccccacgccgctgttcgatgtcgtg
gccaactgcatcacgattcgcggctcgttcgtcggcaatcgccgcgatatggcggaagcg
ctggcctttgccgccgacggcaaggtcagggccgacatcgagctgcagccgctgtcggcg
atcaacaacgtgttccagcgtctgggacacggcgatgtaccgtcgcgcgtggtgctcgag
ttcgcgagccactga

DBGET integrated database retrieval system