KEGG   Burkholderia xenovorans LB400: Bxe_C0527Help
Entry
Bxe_C0527         CDS       T00340                                 

Definition
putative Zinc-containing alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bxe_C0527
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bxe_C0527
  Lipid metabolism
   00071 Fatty acid degradation
    Bxe_C0527
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bxe_C0527
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bxe_C0527
   00626 Naphthalene degradation
    Bxe_C0527
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bxe_C0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:544348..545382
Genome map
AA seq 344 aa AA seqDB search
MKTHMQAAVVEQFGKPLVLKELAIPTPGPGQVLVKTEACGVCHTDLHATNGDWPLKPGLP
FTPGHEGIGIVAALGAGVTAVKEGDRIGVPWLYSACGHCEYCLAAREPVCAEAQFGGYTK
NGGFAEYIVADPNYVAHIPAGLAAREAAPLICAGITSYKGIKETQARPGEWVVISGVGGL
GHLGIQYAKAMGLQVCAVDIDDGKLAHAKRLGADAVVNANDGDPIAAVIRATGGGAHGVL
ITAPSLGAFKQGVGMTRKCGTCVLVGLPPGEFPTPLFDVVANCITIRGSFVGNRRDMAEA
LAFAADGKVRADIELQPLSAINNVFQRLGHGDVPSRVVLEFASH
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcacatgcaagccgctgtggtcgaacagttcggcaagccgctggtactgaag
gagctcgccattccgacaccgggtccgggccaggtgctggtcaagaccgaggcctgcggc
gtatgccataccgatctgcatgcgaccaacggcgactggccgctcaagcccggtttgcca
ttcacgccggggcatgagggtattggtattgtcgccgccctcggcgcgggtgtgacggcg
gtgaaggagggcgaccggatcggcgtgccctggctgtattccgcctgtgggcactgcgag
tactgccttgcggcacgcgagcccgtctgcgccgaagcacagttcggcggctacacgaag
aacggcggctttgccgaatacatcgtggctgacccgaactacgtcgctcacataccggca
ggtctggctgcccgcgaagcagcaccgctcatctgcgccggcatcacttcgtacaagggc
atcaaggagacccaggcgcggccgggtgaatgggtcgtgatctcaggcgtcggcggacta
gggcacctgggtatccagtacgccaaagcgatgggcttgcaggtgtgcgccgtcgatatc
gacgacggcaagctagcccatgcgaaacgcctcggcgccgacgccgtggttaatgcgaac
gacggcgacccgattgccgccgtgataagggccactggcggcggcgcgcatggcgtgctg
attacggcgccctctcttggggcgttcaaacagggcgtcggcatgacgcgcaaatgcggt
acctgcgtgctggtcggactgccgccgggtgaattccccacgccgctgttcgatgtcgtg
gccaactgcatcacgattcgcggctcgttcgtcggcaatcgccgcgatatggcggaagcg
ctggcctttgccgccgacggcaaggtcagggccgacatcgagctgcagccgctgtcggcg
atcaacaacgtgttccagcgtctgggacacggcgatgtaccgtcgcgcgtggtgctcgag
ttcgcgagccactga

DBGET integrated database retrieval system