KEGG   Burkholderia xenovorans: Bxe_C1113Help
Entry
Bxe_C1113         CDS       T00340                                 

Definition
putative amine oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bxe  Burkholderia xenovorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bxe00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1159607..1161118)
Genome map
AA seq 503 aa AA seqDB search
MKAIETSVSDPDASRASALLRNPAAWQRARNDTTAPSGGKGSAIVVGSGIAGLTAAYRMH
QAGMQVTVLEANGVVGGRMGDRRVGDIAFNSGARLVYPFGSAFNRLIADLSLHDVLIPLR
HLTAQCVSPSGSHTIELMPSVRSLATPGLPMRERFALVSHALRMRAQRSRVDPDWAISAI
ADDPAADRQTLAEYVRDAIGPQALSSMIEPVFRSTRSFNPETLSALFYRSTVPHLIGEDT
VYTLKGGMGCVCQALAGRLDVRTNAPVASIETMRDAVPDRRDGAAASTENVAARGRRCAV
TLSDGTVLTADHVVCATEGSLAGALVRNPQREEREMLQAVRYNALGVVHYGFSQPLPPTM
QFALRGAPGRISTFQQLPAAPANGRPLTQIYCQLTPEAAGEAERRGLTDNLDVLLRDELR
ARIPGFDRHVSAVVNQWIPRKLPVFAPGYGERLQAFWRWQENAAHNAERPVVYCGDWTSQ
ALLTGACASGERAARIVLSRTQN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgaaacgtctgtatcggaccccgatgcgtctcgcgcatcggcactgttg
cgcaatcctgccgcatggcaacgcgcgcggaacgatacaacggcgccatcgggcggaaaa
ggaagcgcgattgtcgtgggctccggtattgccggtttgaccgcggcttaccgcatgcat
caggcgggtatgcaggtgaccgtgctcgaagcgaacggcgtcgttggcggccgcatgggc
gaccggcgcgtgggtgatatcgcgttcaatagcggcgcgcgtctcgtgtatccgttcggc
agcgctttcaaccggctgatcgcggatctttcgcttcacgacgtgctgattccgctgcgt
catctgacggcgcaatgcgtttcgcccagcggcagccacaccatcgagctcatgccttcc
gttcgctcgctggccacgcccggtctgccgatgcgcgagcgcttcgcgctggtgagccat
gcgctcagaatgcgcgcgcaacgcagccgcgtcgatccggactgggcgatcagcgcaatc
gccgacgaccctgccgccgatcgccaaaccctcgccgaatacgtgcgcgacgcgatcgga
ccgcaggccctctccagcatgattgaaccggtgttccgctcgacccgcagcttcaatccc
gaaacgctgtccgcgctgttttaccgttcaaccgtgccgcatctgattggcgaagatacc
gtgtacacgttgaagggcggcatgggctgcgtgtgccaggcgctggccgggcggctcgac
gtgcgcacgaatgcgcccgtcgcttcgattgaaaccatgcgggacgccgtgcctgacagg
cgcgacggcgcggcggcgagtaccgaaaacgtcgcggcgcgcggccggcgttgcgccgtg
acgctgagcgacggcacggtgctgacggcggaccacgtcgtgtgtgcaaccgaaggctcg
ctcgcgggcgcgctggtccgaaatccacagcgcgaggagcgcgagatgttgcaggcggtg
cgctacaacgcgctcggcgtcgtccactacggtttttcgcagccgctcccgccgacgatg
cagtttgcgttgcgtggcgcgcccggtcgcatttcgactttccagcaactgcccgccgcg
cccgccaacgggcggccgctcacgcagatctattgccagctcacgccggaagccgccggg
gaggctgagcgccgcggtctgaccgacaacctcgatgtactgctgcgcgacgaactgcgc
gcgcggattcccgggttcgaccgtcatgtgagcgcggtcgtgaatcagtggattccccgc
aagttgccggtattcgcgccgggctacggcgagcgtttgcaggcgttctggcgctggcag
gagaacgccgcgcacaacgctgaacgcccggtcgtctactgcggcgactggacttcccag
gcgctgttgacgggcgcgtgcgcgagcggtgaacgcgccgcgcggatcgtgctgtcgcgc
acgcaaaactag

DBGET integrated database retrieval system