KEGG   Paraburkholderia xenovorans LB400: Bxe_C1113Help
Entry
Bxe_C1113         CDS       T00340                                 

Definition
(GenBank) Putative amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
bxe  Paraburkholderia xenovorans LB400
Pathway
bxe00860  Porphyrin and chlorophyll metabolism
bxe01100  Metabolic pathways
bxe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bxe_C1113
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Bxe_C1113
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Bxe_C1113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 FAD_oxidored Pyr_redox_2 Thi4 DAO Pyr_redox HI0933_like AlaDh_PNT_C GIDA FAD_binding_3 MCRA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABE36979
JGI: BxeC1113
UniProt: Q13G10
Position
3:complement(1159607..1161118)
Genome map
AA seq 503 aa AA seqDB search
MKAIETSVSDPDASRASALLRNPAAWQRARNDTTAPSGGKGSAIVVGSGIAGLTAAYRMH
QAGMQVTVLEANGVVGGRMGDRRVGDIAFNSGARLVYPFGSAFNRLIADLSLHDVLIPLR
HLTAQCVSPSGSHTIELMPSVRSLATPGLPMRERFALVSHALRMRAQRSRVDPDWAISAI
ADDPAADRQTLAEYVRDAIGPQALSSMIEPVFRSTRSFNPETLSALFYRSTVPHLIGEDT
VYTLKGGMGCVCQALAGRLDVRTNAPVASIETMRDAVPDRRDGAAASTENVAARGRRCAV
TLSDGTVLTADHVVCATEGSLAGALVRNPQREEREMLQAVRYNALGVVHYGFSQPLPPTM
QFALRGAPGRISTFQQLPAAPANGRPLTQIYCQLTPEAAGEAERRGLTDNLDVLLRDELR
ARIPGFDRHVSAVVNQWIPRKLPVFAPGYGERLQAFWRWQENAAHNAERPVVYCGDWTSQ
ALLTGACASGERAARIVLSRTQN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattgaaacgtctgtatcggaccccgatgcgtctcgcgcatcggcactgttg
cgcaatcctgccgcatggcaacgcgcgcggaacgatacaacggcgccatcgggcggaaaa
ggaagcgcgattgtcgtgggctccggtattgccggtttgaccgcggcttaccgcatgcat
caggcgggtatgcaggtgaccgtgctcgaagcgaacggcgtcgttggcggccgcatgggc
gaccggcgcgtgggtgatatcgcgttcaatagcggcgcgcgtctcgtgtatccgttcggc
agcgctttcaaccggctgatcgcggatctttcgcttcacgacgtgctgattccgctgcgt
catctgacggcgcaatgcgtttcgcccagcggcagccacaccatcgagctcatgccttcc
gttcgctcgctggccacgcccggtctgccgatgcgcgagcgcttcgcgctggtgagccat
gcgctcagaatgcgcgcgcaacgcagccgcgtcgatccggactgggcgatcagcgcaatc
gccgacgaccctgccgccgatcgccaaaccctcgccgaatacgtgcgcgacgcgatcgga
ccgcaggccctctccagcatgattgaaccggtgttccgctcgacccgcagcttcaatccc
gaaacgctgtccgcgctgttttaccgttcaaccgtgccgcatctgattggcgaagatacc
gtgtacacgttgaagggcggcatgggctgcgtgtgccaggcgctggccgggcggctcgac
gtgcgcacgaatgcgcccgtcgcttcgattgaaaccatgcgggacgccgtgcctgacagg
cgcgacggcgcggcggcgagtaccgaaaacgtcgcggcgcgcggccggcgttgcgccgtg
acgctgagcgacggcacggtgctgacggcggaccacgtcgtgtgtgcaaccgaaggctcg
ctcgcgggcgcgctggtccgaaatccacagcgcgaggagcgcgagatgttgcaggcggtg
cgctacaacgcgctcggcgtcgtccactacggtttttcgcagccgctcccgccgacgatg
cagtttgcgttgcgtggcgcgcccggtcgcatttcgactttccagcaactgcccgccgcg
cccgccaacgggcggccgctcacgcagatctattgccagctcacgccggaagccgccggg
gaggctgagcgccgcggtctgaccgacaacctcgatgtactgctgcgcgacgaactgcgc
gcgcggattcccgggttcgaccgtcatgtgagcgcggtcgtgaatcagtggattccccgc
aagttgccggtattcgcgccgggctacggcgagcgtttgcaggcgttctggcgctggcag
gagaacgccgcgcacaacgctgaacgcccggtcgtctactgcggcgactggacttcccag
gcgctgttgacgggcgcgtgcgcgagcggtgaacgcgccgcgcggatcgtgctgtcgcgc
acgcaaaactag

DBGET integrated database retrieval system