KEGG   Burkholderia xenovorans: Bxe_C1188Help
Entry
Bxe_C1188         CDS       T00340                                 

Gene name
bphJ
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bxe  Burkholderia xenovorans
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bxe00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bxe00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:bxe00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:bxe00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:bxe00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1245985..1246899)
Genome map
AA seq 304 aa AA seqDB search
MTKKIKCALIGPGNIGTDLLAKLQRSPVLEPIWMVGIDPESDGLKRAREMGIKTTADGVD
GLIPHMQADGVQIVFDATSAYVHADNSRKVNALGALMIDLTPAAIGPFCVPTVNLKEHVG
KGEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSKSAGPGTRKNIDEFTRTTAG
AVEKVGGAKKGKAIIILNPAEPPLIMRDTVHCLLESEPDQAKITESIHAMIKEVQKYVPG
YKLVNGPVFDGLRVSVYLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGQLTLQ
PVHA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaatcaaatgcgccctgatcggccccggcaacatcggcaccgacctgctg
gccaagctgcagcgcagcccggtattggaacccatctggatggtcggcatcgaccccgaa
tccgacggcctcaagcgcgcccgcgagatgggcatcaagaccaccgctgacggtgtcgat
gggttgattccccacatgcaggccgacggcgtgcagatcgtcttcgatgccaccagcgcc
tacgtgcatgctgacaacagccgcaaggtgaatgccctcggcgccctgatgatagacctg
accccggcggccatcggccccttctgcgtgccgacggtcaacctcaaggaacatgtcggc
aaaggcgagatgaacgtcaacatggtcacctgcggcggccaggccaccattcccatggtc
gcggccgtgagccgcgtccagccggtggcctacggcgaaatcgtcgccaccgtctcgagc
aagtccgccggacccggaacgcgcaagaacatcgacgaattcacccgcaccaccgccggc
gcggtcgaaaaggtcggtggcgccaaaaagggcaaggccatcatcatcctcaacccggcc
gagcccccgctgatcatgcgcgacaccgtgcactgcctgctggagagcgaacccgatcag
gccaagatcaccgagtccatccacgccatgatcaaagaggtgcagaagtacgtgcccggc
tacaagctggtcaacggcccggttttcgacggcttgcgcgtctcggtctacctggaagtc
gagggcctgggcgactacctgcccaaatacgccggcaacctcgacatcatgacggcggcg
gcggcccgcaccgccgagatgtttgccgaggaaatcctcgccgggcagttgacactccag
cccgtccacgcctga

DBGET integrated database retrieval system