KEGG   Burkholderia xenovorans LB400: Bxe_C1188Help
Entry
Bxe_C1188         CDS       T00340                                 

Gene name
bphJ
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
bxe  Burkholderia xenovorans LB400
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bxe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bxe_C1188 (bphJ)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bxe_C1188 (bphJ)
   00650 Butanoate metabolism
    Bxe_C1188 (bphJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bxe_C1188 (bphJ)
   00622 Xylene degradation
    Bxe_C1188 (bphJ)
   00621 Dioxin degradation
    Bxe_C1188 (bphJ)
Enzymes [BR:bxe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Bxe_C1188 (bphJ)
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Bxe_C1188 (bphJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1245985..1246899)
Genome map
AA seq 304 aa AA seqDB search
MTKKIKCALIGPGNIGTDLLAKLQRSPVLEPIWMVGIDPESDGLKRAREMGIKTTADGVD
GLIPHMQADGVQIVFDATSAYVHADNSRKVNALGALMIDLTPAAIGPFCVPTVNLKEHVG
KGEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIVATVSSKSAGPGTRKNIDEFTRTTAG
AVEKVGGAKKGKAIIILNPAEPPLIMRDTVHCLLESEPDQAKITESIHAMIKEVQKYVPG
YKLVNGPVFDGLRVSVYLEVEGLGDYLPKYAGNLDIMTAAAARTAEMFAEEILAGQLTLQ
PVHA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaaaatcaaatgcgccctgatcggccccggcaacatcggcaccgacctgctg
gccaagctgcagcgcagcccggtattggaacccatctggatggtcggcatcgaccccgaa
tccgacggcctcaagcgcgcccgcgagatgggcatcaagaccaccgctgacggtgtcgat
gggttgattccccacatgcaggccgacggcgtgcagatcgtcttcgatgccaccagcgcc
tacgtgcatgctgacaacagccgcaaggtgaatgccctcggcgccctgatgatagacctg
accccggcggccatcggccccttctgcgtgccgacggtcaacctcaaggaacatgtcggc
aaaggcgagatgaacgtcaacatggtcacctgcggcggccaggccaccattcccatggtc
gcggccgtgagccgcgtccagccggtggcctacggcgaaatcgtcgccaccgtctcgagc
aagtccgccggacccggaacgcgcaagaacatcgacgaattcacccgcaccaccgccggc
gcggtcgaaaaggtcggtggcgccaaaaagggcaaggccatcatcatcctcaacccggcc
gagcccccgctgatcatgcgcgacaccgtgcactgcctgctggagagcgaacccgatcag
gccaagatcaccgagtccatccacgccatgatcaaagaggtgcagaagtacgtgcccggc
tacaagctggtcaacggcccggttttcgacggcttgcgcgtctcggtctacctggaagtc
gagggcctgggcgactacctgcccaaatacgccggcaacctcgacatcatgacggcggcg
gcggcccgcaccgccgagatgtttgccgaggaaatcctcgccgggcagttgacactccag
cccgtccacgcctga

DBGET integrated database retrieval system