KEGG   Burkholderia xenovorans: Bxe_C1266Help
Entry
Bxe_C1266         CDS       T00340                                 

Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bxe  Burkholderia xenovorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bxe01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bxe00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bxe00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bxe00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bxe00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bxe00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(1323916..1324926)
Genome map
AA seq 336 aa AA seqDB search
MKVYRFDQAGSLDHLTLHDEPTPEPQRGEVLIRVRASSLNYRDIAMVHGTYLRAQRAGLI
PLSDAAGEIVAVGEDVVDFKVGERVINTFHPRWYGGNPPPTLGSEGYGSHRDGWLSEYKV
VSQEAIVAAPPGLSFEEAATLPCAALTAWTSLSGLRPLRPGQTVLTQGSGGVSVFAVQLA
KLLGARVIATTSSAEKAARLKALGADEVINYVETPAWGERVRELTEGRGVDRVLEVGGPG
TLEQSIKAVASRGEVALIGFLASGDSGVGFNDLFRSGGVFYRISVGDRSGLLELVRAVTS
SGLKPVIDTVFPFERALDAWHHFDDRAFFGKVVISH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgtatcgcttcgatcaagccggcagtctcgaccatctgacgcttcacgacgaa
cccacgcccgagccccagcgcggcgaagtgctgatccgggtgcgcgcgtcgtcgctcaac
tatcgcgacatcgcgatggttcacggcacctacctgcgcgcgcagcgggcgggcctgatt
ccgctcagcgatgccgccggcgagatcgtcgccgtgggggaggacgtggtcgacttcaag
gtcggcgagcgggtcatcaatacgtttcatccgcgctggtacggtggcaatccgccaccc
acgctcggctcggagggctacggctcacatcgcgacggctggctgagcgaatacaaggtc
gtcagccaggaagcgatcgtggcagcgccccccggcctctcgttcgaggaagcggcaacg
ttgccttgcgcggcgctgactgcatggacctcactgtccggattgcgaccgctgcgtccc
ggacaaaccgtgttgacccagggcagcggcggcgtctcggtattcgcggtccagcttgcc
aaactgctgggcgcgcgcgtcatcgccacgacttcttcggcggaaaaggcggcgcggctc
aaggcgctcggcgccgatgaagtgatcaattatgtcgagacgccggcgtggggcgagcgg
gtccgcgagctcaccgagggacgcggcgtcgatcgggtgctcgaggtcggcggcccaggc
acgctcgaacagtcgatcaaggccgtggcgagccgcggcgaagtcgcgctgatcggcttt
ctcgcctcaggcgattccggcgtcgggttcaacgacctgtttcgcagcggcggcgttttc
taccggatttcggtcggcgaccgctcggggctgctggaactggtgcgtgccgtcacgtca
tccggcctgaagccggtcatcgacaccgtatttccgttcgagcgtgcgcttgacgcctgg
catcacttcgacgaccgcgccttcttcggcaaggttgtcatctctcactga

DBGET integrated database retrieval system